(data stored in ACNUC7421 zone)

EMBL: CP000438.PE95

CP000438.PE95        Location/Qualifiers
FT   CDS_pept        complement(110972..111205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01130"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15049"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKA1"
FT                   /protein_id="ABJ15049.1"
FT                   /translation="MAIEKGEAFARRDIYIDYDFEDVTYRWDHRQGTIHVRFYGEAESP
FT                   EPVEHDNRLFNDALRFGREITREEYETGFPKG"
     atggcaattg aaaagggcga agcgttcgcc aggcgcgata tctacatcga ctacgacttc        60
     gaagacgtca cctaccgctg ggaccatcgg cagggcacga tccacgtgcg cttctacggc       120
     gaagccgaat cccccgagcc ggttgagcac gacaaccgcc tgttcaacga tgcgctgcgt       180
     ttcggccggg aaatcacccg cgaggagtac gagacgggct ttcccaaggg ctga             234
//

If you have problems or comments...

PBIL Back to PBIL home page