(data stored in ACNUC7421 zone)

EMBL: CP000438.PE96

CP000438.PE96        Location/Qualifiers
FT   CDS_pept        complement(111195..112514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01140"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15050"
FT                   /db_xref="GOA:A0A0H2ZJS4"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJS4"
FT                   /protein_id="ABJ15050.1"
FT                   /translation="MVAGAVAGALIGAAVVAATAATGGLAAVILAGSIAAGGLSMFQIV
FT                   KGLTTIFELPEPTTGVLIRGSFNVYVNSRNAMRAGDDVSATCSGLPLNHPLWPFPVLIA
FT                   EGSATVYINGKPAARLQSKMVCGAHIKTGSQNTFIGGPTERVAFVLDLEEWLHTGLEAL
FT                   GLAALAGGLLLAAMAGVAALVGVVAIGGLMMGGMALLGDLGDRLGPGYRDLFQGVAGMA
FT                   LLGFGPKMARLGNAPKGAPKTQVPKGFEKVYGKAPAAKAEIDAVADGLAAKHGGRVAKA
FT                   PIKSRERAMQKINNDYKGDPTKIKDLARNTIIVEGDKVNTVAAELANRGAKVKVIDGNA
FT                   DPLGYSGVNSTMNTKAGIPGEIQVNSPEMIYAKESEDMARILLGNDTYDAVAAKAGVPG
FT                   GQGHKYYEDWRVLDPKSPEAQAIAEKSRAYYDAVRKGNGN"
     atggtcgccg gagccgtggc cggagccctg atcggcgccg ccgtggtcgc cgccaccgcc        60
     gccaccggcg gcctggccgc ggtgatcctg gccggttcga tcgccgccgg cgggctgtcg       120
     atgttccaga tcgtcaaggg cctgaccacc atcttcgagc tacccgagcc gaccaccggg       180
     gtgctcatac gcggcagctt caacgtctac gtgaacagtc gcaacgcgat gcgcgccggc       240
     gacgacgtct ccgccacctg cagcggcctg ccgctgaacc atccgctgtg gccgttcccg       300
     gtgctgatcg ccgaaggcag cgccaccgtg tacatcaacg gcaagccggc ggcgcgcctg       360
     cagagcaaga tggtctgcgg cgcgcacatc aagaccggca gccagaacac cttcatcggc       420
     ggccccaccg agcgggtggc cttcgttctc gatctggagg aatggctgca caccggcctc       480
     gaggcgctgg gcctggcggc ccttgccggc ggcctgctgc tggcggcgat ggccggggtc       540
     gcggcgctgg ttggagtggt cgccatcggc gggctgatga tgggcggcat ggccctgctc       600
     ggcgacctcg gcgaccgcct cggtcccggc taccgcgacc tgttccaggg cgtggccggc       660
     atggcgctgc tgggcttcgg accgaagatg gcacggctcg gcaacgcacc caagggcgcg       720
     ccgaagaccc aggtgccgaa aggcttcgag aaggtctatg gcaaggcgcc ggcagccaag       780
     gccgagatcg acgcggtggc cgacggactg gcggctaagc acggcggcag ggtcgccaag       840
     gcaccgatca agtcgcgcga acgcgccatg cagaagatca acaacgacta caagggcgat       900
     ccgaccaaga tcaaggacct ggcccgcaac accatcatcg tcgaaggcga caaggtgaac       960
     accgttgccg ccgagctggc caaccgcggc gccaaggtca aggtgatcga cggcaacgcc      1020
     gacccgctcg gctacagcgg ggtgaactcg acgatgaaca ccaaggccgg gatacccggc      1080
     gagatccagg tcaactcgcc ggagatgatc tacgccaagg agtcggagga catggctcgc      1140
     atcctcctcg gcaacgacac ctacgacgcg gtggcggcca aggccggcgt acccggaggg      1200
     cagggccaca agtactatga ggactggcgg gtactggatc cgaagtcccc ggaggcccag      1260
     gccatcgccg agaagagccg ggcgtactac gacgcagtga ggaaaggcaa tggcaattga      1320
//

If you have problems or comments...

PBIL Back to PBIL home page