(data stored in ACNUC7421 zone)

EMBL: CP000438.PE97

CP000438.PE97        Location/Qualifiers
FT   CDS_pept        complement(112593..113027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01150"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15051"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ35"
FT                   /protein_id="ABJ15051.1"
FT                   /translation="MTLYRLHEADLEIPDAWQDQSINIFKLPASGPAREASFVISRDAS
FT                   QGDAPFADYVARQLENAEKQLPGFKLHKRWDINIHGHAAVLLDYQWQREGRDLMLRQVF
FT                   IERRPAVLITTLTTTPADLPHHEPAWKQAMQTLVPRPTPS"
     gtgacgctct atcgcctcca cgaagccgat ctcgagattc ccgatgcctg gcaggaccag        60
     agcatcaaca tcttcaagct ccccgccagc ggccccgccc gcgaagccag tttcgtcatc       120
     agccgcgacg ccagccaggg cgacgcgccg ttcgccgact atgtcgcccg ccaactggaa       180
     aacgccgaga agcaattgcc cggcttcaag ctgcacaagc gctgggacat caacatccac       240
     ggccacgccg ccgtgctcct cgactaccag tggcagcgcg agggccgcga cctgatgctg       300
     cgccaggtat tcatcgagcg ccgcccggcg gtgctgatca ccaccctgac caccaccccg       360
     gctgacctgc cgcaccacga gccggcctgg aagcaggcga tgcagaccct ggtcccgcgc       420
     ccgaccccta gctga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page