(data stored in ACNUC7421 zone)

EMBL: CP000438.PE98

CP000438.PE98        Location/Qualifiers
FT   CDS_pept        113281..115506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01160"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15052"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR010609"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK27"
FT                   /protein_id="ABJ15052.1"
FT                   /translation="MALAQQTRLVRVDSPLGAEVLQLQRMEGREELGRPFAYELELISE
FT                   NPDLPLDGLLGKPASLALELHDGSRRHFHGIVAACSQGSGNGQFASYQVTLRPWLWLLT
FT                   RTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRSYREWEYCVQYRETSFDFVSRLME
FT                   QEGIYYWFRHERNRHILVLSDAYGAHQSPPNYASVPYYPPTLEQRERDHFYDWHMAREV
FT                   QSGSLSLNDYDFQRPGARLEVRSNIARSHAAADYPLYDYPGEYVQSQDGEQYARTRIEA
FT                   LQARYERVRLRGRARGLGSGHLFKLSGYPREDQNREYLVVGADYRVVQELYETGGGGVG
FT                   AQFESELDCIDAGQAYRPLPTTPLPIVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDR
FT                   HDQSNENSSCWIRVSQAWAGKNWGSVQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQT
FT                   VPYELPANATQSGTKSRSSKGGTPANFNEIRMEDKKGAEQLFIHAEKNQDIEVENDESH
FT                   WVGHDRTKTIDYDETVHVKHDRTETVDNNETITIGVDRTEKVGNNEKISIGANRTEDVG
FT                   SNETISIGVDRTEKVGSNEKISIGANRTEDVGNDETISIGANRSESVGNNETISIGADR
FT                   SESVGANETIDIGGNQSTSIGKNESRSVGQGRDTSVGKDDSLDVGKSFTLNAGDSITLV
FT                   TGAASIRMKKDGSIVISGKNITIDGSGAINIKADKNVVVKGRKILQN"
     atggcacttg cgcaacagac ccgcctggtc cgggtcgaca gtccgctcgg cgcggaggtc        60
     ctgcaattgc agcgaatgga gggtcgcgaa gagctcggcc ggccgttcgc ctacgagctg       120
     gaactgatct cggaaaaccc cgacctgcca ctcgacgggc tgctgggcaa gccggccagc       180
     ctggcgctgg aactgcacga cggcagccgg cggcatttcc acggcatcgt cgccgcttgc       240
     agccagggat ccggcaacgg ccagttcgcc agctaccagg tcaccctgcg cccctggctg       300
     tggctgctga cgcgcacctc cgactgccgc atcttccaga accagaaggt cccggacatc       360
     atcaagcagg tgttccgcga cctcggcttc tccgacttcg aggacgccct gagccgctcc       420
     taccgcgagt gggaatactg cgtgcagtac cgcgagacca gtttcgactt cgtcagccgg       480
     ctgatggagc aggaaggcat ctactactgg ttccgccacg agcggaatcg gcacatcctg       540
     gttctatccg acgcctatgg cgcgcaccag agcccgccga actacgccag cgtgccctac       600
     tacccgccga ccctggaaca gcgcgagcgc gaccatttct acgactggca catggcgcgc       660
     gaggtgcagt ccggctcact gagcctcaac gactacgact tccagcgtcc cggcgcgcgc       720
     ctggaggtgc gttcgaacat cgcccgctcg cacgcggcgg ccgactaccc gctgtacgac       780
     taccctggcg aatacgtaca gagccaggac ggcgagcagt acgcgcggac ccgtatcgaa       840
     gccttgcagg cgcgctacga acgggtgcgc ctgcgcggcc gcgcccgcgg cctgggttcc       900
     ggccacctgt tcaagctcag cggctacccg cgcgaggacc agaaccgcga gtacctggtg       960
     gtcggcgccg attaccgggt ggtccaggaa ctctacgaga ccggcggcgg cggggtgggc      1020
     gcgcagttcg aaagcgagct ggactgcatc gatgccggcc aggcctaccg ccccttgccg      1080
     accactccgc tgccgatcgt ccgtggcccg cagactgcgg tggtggtcgg gcccaagggc      1140
     gaggagatct ggaccgacca gtacggccgg gtcaaggtgc atttccactg ggaccgccac      1200
     gaccagtcca acgagaacag ctcctgctgg atacgcgtct cccaggcctg ggcggggaag      1260
     aactggggct cggtgcagat cccgcggatc ggccaggaag tgatcgtcag cttcctcgaa      1320
     ggcgacccgg accgtccgat catcaccggg cgggtctaca acgccgagca gacggtgccc      1380
     tacgagctgc cggcgaacgc cacccagagc ggcaccaaga gccgttcgag caagggcggc      1440
     acgccggcca acttcaacga gatccgcatg gaggacaaga agggcgccga gcagttgttc      1500
     atccatgccg agaagaacca ggacatcgag gtcgagaacg acgagagcca ctgggtcggc      1560
     cacgaccgga ccaagaccat cgactacgac gagacggtgc atgtgaagca cgatcgcacc      1620
     gagaccgtgg acaacaacga gaccataacc atcggcgtcg accgcaccga gaaggtcggt      1680
     aacaacgaga agatcagtat cggcgcgaac cgcaccgagg acgtcggcag caacgagacc      1740
     atcagcatcg gcgtcgaccg caccgagaag gtcggcagca acgagaagat cagcatcggt      1800
     gccaatcgca ccgaggacgt cggcaacgac gagaccatca gcatcggcgc gaaccgtagc      1860
     gagtcggtgg gcaacaacga gacgatcagc atcggcgccg accgcagcga gtcggtgggc      1920
     gccaacgaga ccatcgacat aggcggcaac cagagcacca gcatcggcaa gaacgagtcg      1980
     cgcagcgtcg gccagggccg cgatacctcg gtgggcaagg acgatagcct ggacgtgggc      2040
     aagagcttca cgctcaatgc cggcgactcg atcaccctgg tcaccggtgc cgccagcatc      2100
     cgcatgaaga aggacggcag catcgtcatc agcggcaaga acatcaccat cgacggatcc      2160
     ggggcgatca acatcaaggc cgacaagaac gtggtggtga agggacgcaa gatcctccag      2220
     aactga                                                                 2226
//

If you have problems or comments...

PBIL Back to PBIL home page