(data stored in ACNUC7421 zone)

EMBL: CP000438.PE99

CP000438.PE99        Location/Qualifiers
FT   CDS_pept        115534..115983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01170"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK40"
FT                   /protein_id="ABJ15053.1"
FT                   /translation="MSVEIHLPGATTALPARLDGVVIGVLLDVPDAAAPVVAYPGCPSE
FT                   HGLAAATTTQLSRADIGAQVALMFVAGDPRQPLLIGRIQRLPQEALAQLDGERLEFSAE
FT                   REIVLRCGKASITLTRAGKVIIHGAYLSSRSTGVNRIKGGSVQIN"
     atgagtgtcg agatccatct acctggggcc acgacggccc ttcccgcgcg cctggacggc        60
     gtggtcatcg gcgtcctcct cgacgtgccg gacgccgccg ctccggtggt cgcctatccc       120
     ggttgcccga gcgagcacgg cctggcggcg gccaccacca ctcagctcag tcgcgccgac       180
     atcggcgccc aggtagcgct gatgttcgtc gccggcgatc cgcgccagcc gctgctgatc       240
     ggccgcatcc agcgcctgcc gcaggaagcg ctggcgcaac tggacggcga gcgcctggag       300
     ttcagtgccg aacgcgagat cgtcctgcgc tgcggcaagg ccagcatcac cctgacccgc       360
     gccggcaagg tgatcatcca tggcgcctac ctctccagcc gctccaccgg ggtcaaccgg       420
     atcaagggcg gttcggtgca gatcaactga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page