(data stored in ACNUC7421 zone)

EMBL: CP000438.PGK

CP000438.PGK         Location/Qualifiers
FT   CDS_pept        621256..622419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="PA14_07190"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07190"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15515"
FT                   /db_xref="GOA:Q02TL3"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TL3"
FT                   /protein_id="ABJ15515.1"
FT                   /translation="MTVLKMTDLDLKGKRVLIREDLNVPVKDGQVQSDARIKAALPTLK
FT                   LALEKGAAVMVCSHLGRPTEGEFSAENSLKPVAEYLSKALGREVPLLADYLDGVEVKAG
FT                   DLVLFENVRFNKGEKKNADELAQKYAALCDVFVMDAFGTAHRAEGSTHGVARFAKVAAA
FT                   GPLLAAELDALGKALGNPARPMAAIVAGSKVSTKLDVLNSLAGICDQLIVGGGIANTFL
FT                   AAAGHKVGKSLYEADLVETAKAIAAKVKVPLPVDVVVAKEFAESAVATVKAIAEVADDD
FT                   MILDIGPQTAAQFAELLKTSKTILWNGPVGVFEFDQFGEGTRTLANAIADSAAFSIAGG
FT                   GDTLAAIDKYGIAERISYISTGGGAFLEFVEGKVLPAVEILEQRAKG"
     atgaccgtgt tgaagatgac tgacctcgac ctcaaaggta agcgcgtgct gatccgcgag        60
     gacctcaacg tgcccgtgaa ggacggccag gtgcagagcg atgcacggat caaggccgcc       120
     ctgccgaccc tcaagctggc cctggagaag ggcgcggcgg tgatggtctg ctcgcacctg       180
     ggccgtccga ccgagggcga gttctccgcc gagaacagcc tgaagccggt ggccgagtac       240
     ctgtccaagg ccctgggccg cgaagtgccg ctgctggccg actacctcga cggcgtcgag       300
     gtcaaggcgg gcgacctggt gctgttcgag aacgtgcgct tcaacaaggg cgagaagaag       360
     aacgctgacg agctggcgca gaagtacgcc gcgctgtgcg acgtgttcgt gatggatgcc       420
     ttcggtaccg cccaccgcgc cgaggggtcg acccacggcg tggccaggtt cgccaaggtc       480
     gccgccgccg gcccgctgct ggccgccgaa ctggacgcgc tgggcaaggc gctgggcaac       540
     ccggcgcggc cgatggcggc gatcgtcgcc ggctccaagg tttccaccaa gctcgacgtg       600
     ctgaacagcc tggccggcat ctgcgaccag ctgatcgtcg gcggcggcat cgccaacacc       660
     ttcctcgccg cggccggaca caaggtcggc aagtcgctgt acgaggccga cctggtcgag       720
     accgccaagg ccatcgccgc caaggtcaag gtgccgctgc cggtggacgt ggtggtggcc       780
     aaggaattcg ccgagagcgc cgtggcgacc gtcaaggcca tcgccgaggt cgccgacgac       840
     gacatgatcc tcgacatcgg cccgcagacc gccgcgcagt tcgccgagct gctgaagacc       900
     tcgaagacca tcctgtggaa cggtccggtc ggggtgttcg agttcgacca gttcggcgag       960
     ggcacccgta ccctggccaa tgccatcgcc gatagcgcgg cgttctccat cgccggcggc      1020
     ggcgataccc tggcggcgat cgacaagtac ggcatcgccg agcggatctc ctatatttcc      1080
     accggtggcg gcgcgttcct cgagttcgtc gagggcaagg tcctgccggc cgtggaaatc      1140
     ctggagcagc gcgccaaggg ctga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page