(data stored in ACNUC7421 zone)

EMBL: CP000438.PHNA

CP000438.PHNA        Location/Qualifiers
FT   CDS_pept        143458..143799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnA"
FT                   /locus_tag="PA14_01560"
FT                   /product="putative alkylphosphonate uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01560"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15085"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK57"
FT                   /protein_id="ABJ15085.1"
FT                   /translation="MSTLPPCPQCNSEYTYEDGALLVCPECAHEWSPNEAATASDDGKV
FT                   IKDSVGNVLQDGDTITVIKDLKVKGSSLVVKVGTKVKNIRLVDGDHDIDCKIDGIGAMK
FT                   LKSEFVRKV"
     gtgagcacgc tgccgccctg tccccaatgc aactccgaat acacctacga ggatggtgcg        60
     ctgctggtct gcccggagtg cgcccatgaa tggtcgccga acgaggccgc tacggcgtcc       120
     gatgatggca aggtgatcaa ggattcggtg ggcaacgttc tccaggacgg cgataccatc       180
     accgtgatca aggacctgaa agtgaaaggc tcctcgctgg tggtgaaggt cggcaccaag       240
     gtgaagaaca tccgcctggt ggacggcgac cacgacatcg attgcaagat cgacggcatt       300
     ggcgcgatga agctgaaatc ggaattcgtc aggaaggtct ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page