(data stored in ACNUC7421 zone)

EMBL: CP000438.PHZH

CP000438.PHZH        Location/Qualifiers
FT   CDS_pept        64665..66497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phzH"
FT                   /locus_tag="PA14_00640"
FT                   /product="potential phenazine-modifying enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15009"
FT                   /db_xref="GOA:A0A0H2ZJN6"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJN6"
FT                   /protein_id="ABJ15009.1"
FT                   /translation="MCGLAGWVDYTRKLDDEFPAIFAMTDTLALRGPDAEGIWKHRNAL
FT                   LGHRRLAVIDLSGGVQPMSYRFPTGQEVTLVYTGEVYNHDALRERLRRAGHEFRTRSDT
FT                   EVVLHAYLQWGERCCEYLTGMFAFAVFDGRDGHLLLVRDRLGIKPLYYARHREGLLFGS
FT                   EIKSILAHPEFAARLDAVGLVDLLTLSRGTSQTPFREVQELLPGHLLSWRPNSQAKLRR
FT                   YWEVRRQEHADDLQSTVQRTRELVTRALGSQLHADVPVCSLLSGGLDSTALTGIAQRIA
FT                   KAEHGGDINSFSVDFVGQAEQFRSDDLRPDQDQPFALLAAQYIGSRHRTVLIDNAELVC
FT                   ERAREEVFRAKDVPFTFGDMDTSLHLMFGEIRRHSTVAISGEGADELFGGYGWFRDPQA
FT                   VAAARFPWASRVRLPAGFIDAGFNRRCDLLQYQQASYDDGLRQVEHLAGDSPEERRMRE
FT                   FSHLHLKRWMVLLLERKDRLSMCNGLEVRVPYTDHELVEYVYNVPWSIKSRDGEEKWLL
FT                   KRACADYVPEAVLKRRKSPYPTSANLGYERFLRGSVRRLLEDAANPVFGIVSREFLAAE
FT                   LEHPEGYFNTQVSRHNLETALALEGWLRLYGLSA"
     atgtgcggtc tcgcgggttg ggtggattac acgcgcaagc tcgacgacga atttccggcg        60
     atcttcgcca tgaccgatac gctcgccttg cgcgggccgg atgccgaggg catctggaag       120
     caccgcaacg ccctgctggg tcaccggcgg ctggcggtca tcgacctcag cggcggcgtg       180
     cagccgatgt cctatcgctt tcccaccggc caggaggtca ccctcgtcta taccggcgag       240
     gtgtacaacc acgatgccct gcgcgagcgg ttgcgccggg ccggacatga gttccgcacc       300
     cgcagcgata ccgaggtggt cctgcacgcc tatctgcaat ggggcgagcg ttgttgcgag       360
     tacctgaccg ggatgttcgc cttcgccgtc ttcgatggcc gcgacggcca cctgctgctg       420
     gtgcgcgacc gcttgggcat caagccgctg tattacgcgc ggcaccgcga gggactgctg       480
     ttcggctcgg agatcaagtc catcctggcg catccggaat tcgccgccag gctcgacgcg       540
     gtcggcctgg tcgacctcct gacgctgtcc cggggcactt cgcagacgcc attccgcgag       600
     gtccaggaat tgctgcccgg ccacctgctg tcctggcgtc ccaattccca ggcgaagttg       660
     cgccgctatt gggaggtgcg ccgccaggag catgccgacg acctgcagag caccgtgcag       720
     cgcacccgcg aactggtcac ccgcgccctg gggtcgcaat tgcacgccga cgttccggtg       780
     tgttcgctgc tatcgggcgg gctcgattcg accgccctga ccggcatcgc ccagcgcatc       840
     gcgaaggcgg agcacggcgg cgacatcaat tcgttctcgg tggacttcgt cggccaggcc       900
     gagcagttcc gcagcgacga cctgcgtccc gaccaggacc agccgttcgc cctgctggcc       960
     gcgcagtaca tcggcagccg tcaccgcacc gtgctcatcg acaatgccga actggtctgc      1020
     gagcgagcgc gcgaagaggt attccgggcc aaggacgtac ctttcacctt cggcgacatg      1080
     gatacctcgc tgcacctgat gttcggcgag atccgccggc attccacggt ggccatctcc      1140
     ggcgaaggcg ccgacgagct gttcggtggc tacggctggt tccgcgatcc gcaggcggtg      1200
     gctgcggcgc gcttcccctg ggcctccagg gtgcgcctgc cagccggctt catcgacgcc      1260
     ggtttcaacc gccgctgcga tctcctccag taccagcagg ccagctacga cgatgggctg      1320
     cgccaggtcg aacacctggc cggcgacagc ccggaggagc ggcggatgcg cgagttcagc      1380
     cacctgcatc tgaagcgctg gatggtgctg ctgctcgaac gcaaggatcg cctgagcatg      1440
     tgcaacggcc tggaggtgcg ggtgccctac accgaccatg agctggtgga gtacgtctac      1500
     aacgtgccct ggtcgatcaa gagccgggac ggcgaggaga agtggctgct caagcgggcc      1560
     tgcgccgact atgtcccgga agccgtgctc aagcgccgca agagccctta tccgacttct      1620
     gccaacctcg gctacgagcg tttcctgcgc gggagcgtgc ggcgtctgct ggaggacgcg      1680
     gcgaacccgg tgttcggcat cgtttcgcga gagttcctgg ccgccgaact ggagcatccg      1740
     gaggggtact tcaacaccca ggtgagccgc cacaacctgg agaccgcgct ggcgctggaa      1800
     ggctggctca ggttgtacgg gctctccgcc tga                                   1833
//

If you have problems or comments...

PBIL Back to PBIL home page