(data stored in ACNUC7421 zone)

EMBL: CP000438.PILI

CP000438.PILI        Location/Qualifiers
FT   CDS_pept        465247..465783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilI"
FT                   /locus_tag="PA14_05340"
FT                   /product="type IV pili signal transduction protein PilI"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05340"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15377"
FT                   /db_xref="GOA:A0A0H2ZL98"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL98"
FT                   /protein_id="ABJ15377.1"
FT                   /translation="MSDVQTPFQLLVDIDQRCRRLAAGLPAQQEAVQSWSGIGFRMGGR
FT                   FFVAPMGEVGEVLHEPRYTQLPGVKTWVKGVANVRGRLLPIMDLCGFLGTELSPLRKQR
FT                   RVLVVEHLDVFAGLIVDEVFGMQHFPVDTFSEQLPPLEAALQPFIHGVFHREQPWLVFS
FT                   PHALAQHQGFLDVAV"
     atgtcggacg ttcagacccc cttccagctc ctcgtcgaca tcgatcagcg ctgccgacgc        60
     ctggccgccg gcctgccggc ccagcaggag gcggtgcaga gctggagcgg gatcggcttc       120
     cgcatgggcg ggcggttctt cgtcgccccc atgggggagg tcggcgaagt cctgcacgaa       180
     ccgcgctaca cccagctgcc gggcgtgaag acctgggtca agggggtggc caacgtacgt       240
     ggccgcctgc tgccgatcat ggacctctgc ggtttcctcg gcaccgaact gtcgcccttg       300
     cgcaagcagc ggcgggtgct ggtggtggag cacctggacg tgttcgccgg cctcatcgtc       360
     gatgaggtgt tcggcatgca gcacttcccg gtggacacct tcagcgaaca gctgccgcca       420
     ctagaagcgg cactgcaacc cttcattcat ggcgtcttcc atcgagagca gccgtggctg       480
     gtgttcagcc cgcatgcgct ggcgcaacac cagggcttcc tcgacgtcgc cgtataa          537
//

If you have problems or comments...

PBIL Back to PBIL home page