(data stored in ACNUC7421 zone)

EMBL: CP000438.PILT

CP000438.PILT        Location/Qualifiers
FT   CDS_pept        451306..452340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="PA14_05180"
FT                   /product="twitching motility protein PilT"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05180"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15362"
FT                   /db_xref="GOA:A0A0H2ZKV1"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKV1"
FT                   /protein_id="ABJ15362.1"
FT                   /translation="MDITELLAFSAKQGASDLHLSAGLPPMIRVDGDVRRINLPPLEHK
FT                   QVHALIYDIMNDKQRKDFEEFLETDFSFEVPGVARFRVNAFNQNRGAGAVFRTIPSKVL
FT                   TMEELGMGEVFKRVSDVPRGLVLVTGPTGSGKSTTLAAMLDYLNNTKYHHILTIEDPIE
FT                   FVHESKKCLVNQREVHRDTLGFSEALRSALREDPDIILVGEMRDLETIRLALTAAETGH
FT                   LVFGTLHTTSAAKTIDRVVDVFPAEEKAMVRSMLSESLQSVISQTLIKKIGGGRVAAHE
FT                   IMIGTPAIRNLIREDKVAQMYSAIQTGGSLGMQTLDMCLKGLVAKGLISRENAREKAKI
FT                   PENF"
     atggatatta ccgagctgct cgccttcagt gccaaacagg gcgcttcgga cctgcacctc        60
     tccgccggcc tgccgcccat gatccgggtg gatggcgatg tacgccggat caacctgcca       120
     ccgctggaac acaagcaggt gcatgcgctg atctacgaca tcatgaacga caagcagcgc       180
     aaggacttcg aggaattcct cgagaccgac ttctccttcg aggtgccggg cgtcgcgcgt       240
     ttccgggtca acgccttcaa ccagaaccgt ggcgccggcg cggtattccg gaccattccc       300
     tccaaggtac tgaccatgga ggagcttggc atgggagaag tgttcaaacg tgtttcagac       360
     gtcccgcgcg ggctggtact ggtcaccggg ccgaccggtt cgggcaagtc caccaccctg       420
     gcggcgatgc tcgactacct gaacaacacc aagtaccacc acatcctcac catcgaggac       480
     ccgatcgaat tcgtccacga atcgaagaag tgcctggtca accagcgcga ggtgcatcgc       540
     gacaccctcg gcttcagcga agcgctgcgc tcggcgctgc gggaggaccc ggacatcatc       600
     ctggtcggcg agatgcgcga cctggaaacc atccgcctgg ccctgaccgc ggcggagacc       660
     ggccacctgg tattcggcac cctgcacacc acctcggcgg cgaagaccat cgaccgggtg       720
     gtcgacgtgt tcccggccga ggaaaaggcc atggttcgct cgatgctctc cgagtcgctg       780
     caatcggtga tctcgcagac cctgatcaag aagatcggcg gcggccgggt ggcggcccac       840
     gagatcatga tcggcacccc ggcgatccgc aacctgatcc gcgaggacaa ggtcgcgcag       900
     atgtattcgg cgatccagac cggcggctcg ctgggcatgc agaccctcga catgtgcctc       960
     aagggcctgg tcgccaaggg cctgatcagc cgcgagaatg cccgcgagaa ggcgaagatc      1020
     ccggaaaact tctga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page