(data stored in ACNUC7421 zone)

EMBL: CP000438.PNTB

CP000438.PNTB        Location/Qualifiers
FT   CDS_pept        222339..223775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="PA14_02470"
FT                   /product="pyridine nucleotide transhydrogenase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02470"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15151"
FT                   /db_xref="GOA:A0A0H2ZJD6"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJD6"
FT                   /protein_id="ABJ15151.1"
FT                   /translation="MSMNLVTLLYLIASVCFIQALKGLSHPTTSRRGNLFGMVGMAIAV
FT                   ATTVGLVFKLGAEIATTGVGYIVVGLLVGGTAGSIMAKRVEMTKMPELVAFMHSMIGLA
FT                   AVFIAIAAVVEPQSLGIVAHLGDTIPTGNRLELFLGAAIGAITFSGSVIAFGKLSGKYK
FT                   FRLFQGTPVQFSGQHLLNLVLGLATLGLGLVFMFTGNLTAFAVMLALAFVLGVLIIIPI
FT                   GGADMPVVVSMLNSYSGWAAAGIGFSLNNSMLIIAGSLVGSSGAILSYIMCKAMNRSFF
FT                   NVILGGFGAEADAGGPAGSKEQRPVKSGSADDASFLLTNADSVIIVPGYGLAVARAQHA
FT                   LMELAEKLTHRGVTVKFAIHPVAGRMPGHMNVLLAEAEVPYEQVFEMEDINSEFGQTDV
FT                   VLVLGANDVVNPAAKNDPKSPIAGMPILEAYKAKTVIVNKRSMASGYAGLDNELFYLDK
FT                   TMMVFGDAKKVIEDMVKAVE"
     atgagcatga acctggtcac cctcctgtac ctcatcgcct cggtctgctt catccaggcc        60
     ctgaaaggcc tgtcgcaccc gaccacctcg cgccgcggca acctcttcgg catggtcggc       120
     atggccatcg ccgtggccac caccgtcggc ctggtgttca agctgggcgc ggagatcgcc       180
     accaccggcg tcggctacat cgtcgtcggc ctgctggtcg gcggcaccgc cggctcgatc       240
     atggccaagc gcgtcgagat gaccaagatg cccgagctgg tcgccttcat gcacagcatg       300
     atcggcctgg ccgcggtgtt catcgccatc gccgcggtgg tcgagccgca gtcgctgggg       360
     atcgtcgcgc acctgggcga caccattccc accggcaacc gcctggagct gttcctcggc       420
     gcggccatcg gcgccatcac cttctccggt tcggtgatcg ccttcggcaa gctctccggc       480
     aagtacaagt tccgcctgtt ccagggcacc ccggtgcagt tctccgggca gcacctgctg       540
     aacctggtgc tcggcctggc gaccctcggc ctgggcctgg tgttcatgtt caccggcaac       600
     ctcaccgcct tcgccgtgat gctggcgctg gccttcgtcc tcggcgtgct gatcatcatc       660
     cccatcggcg gcgccgacat gccggtggtg gtgtcgatgc tcaactccta ttccggctgg       720
     gccgcggcgg ggatcggctt ctcgctgaac aactcgatgc tgatcatcgc cggctcgctg       780
     gtcggctcct cgggtgcgat cctctcctac atcatgtgca aggcgatgaa ccgctcgttc       840
     ttcaacgtca tcctcggcgg cttcggcgcc gaagccgacg ccggcggccc ggcgggctcc       900
     aaggagcagc gtccggtgaa gtccggttcg gccgacgatg cctcgttcct gctgaccaac       960
     gccgacagcg tgatcatcgt ccccggctac ggcctggcgg tggcccgcgc ccagcacgcg      1020
     ctgatggaac tggcggagaa gctgacccat cgcggggtca ccgtgaagtt cgccatccac      1080
     ccggtcgccg ggcgcatgcc ggggcacatg aacgtgctgc tggccgaggc cgaggtgccc      1140
     tacgagcagg tgttcgagat ggaggacatc aactccgagt tcggccagac cgacgtggtc      1200
     ctggtgctcg gtgccaacga cgtggtcaac ccggcggcga agaacgatcc gaagtcgccc      1260
     atcgccggca tgccgatcct cgaggcctac aaggccaaga ccgtgatcgt caacaagcgc      1320
     tccatggcca gcggctacgc cggcctggac aacgagctgt tctacctgga caagaccatg      1380
     atggtgttcg gcgacgccaa gaaggtcatc gaagacatgg tcaaggcggt ggagtga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page