(data stored in ACNUC7421 zone)

EMBL: CP000438.PPKA

CP000438.PPKA        Location/Qualifiers
FT   CDS_pept        complement(84645..87743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppkA"
FT                   /locus_tag="PA14_00875"
FT                   /product="serine/threonine protein kinase PpkA"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00875"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15671"
FT                   /db_xref="GOA:A0A0H2ZKT3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKT3"
FT                   /protein_id="ABJ15671.1"
FT                   /translation="MDIELPGFDIERELGEGAMATVYLATQRSLQRKVALKVMAAALAA
FT                   DPSFAERFLREGRTLARLSHPNTVTIHDIGNVGSCYYMAMEYLPNGTLKERIQQGLDPE
FT                   QGLAYVRQVAAALGYAHSQGLVHRDVKPANILFRADGTAVLSDFGIAKSIEDNTQFTQV
FT                   GFAVGTPSYMSPEQARGQEIDGRADLYALGVVLYEILTGKLPYNGKDSLSTALAHLTEP
FT                   LPELPIEQGRYQDILRQLLAKDPAERFPTAGALIAALDRLAPSALEATQIRPLATPQGS
FT                   PRASNPPPAEPAPLPPADLGGLQPVSIQLPPVTPSAGGATPPPPPPSQAAKPPSPPPPP
FT                   LPPAKPRAGGSRTPLIAAAAAAVLLAIGGGAWWLLGSDDAPSPVDPAPLGQTPTDKPQQ
FT                   QTPVADAEQDGGERPLLMPGKKTLFQRVLTKPGAAISAEAGGPPRAGAVPAFSVLYVYA
FT                   RKQVGGSPWLRVGASSNGEGDGWLPASAVSDWKQSLVLKFTERSGRAPVMFLNSAEQVE
FT                   RLLGDTRAARDTLTQAVDHKGDPQVVAVEPNDRAIPQDQFYLLPIFDSKESFDADGQPA
FT                   QLLEVASIDPGGSATAPQAPGQAGRGGASGAASDTFRTGIVLVVDTSVSMQPYIDRVRE
FT                   VIDGLQRQIGERGDLDKVSFGLVGFRNNTDKTPGLEYVSKTLVPLQPGNDAQRFAELSS
FT                   QVRATDVSSHSFNEDAFAGIMQAVDEMDWSPYAGRVVLLVTDAGALRKNDPLGRTQMNE
FT                   AEVRQAALRKGVKIYALHLRTPAGKNNHGYAEQQYRSLTADANPKIADLYIPVAGGEVN
FT                   AFGNTVKEIGTVFADLVHDAGNRKPQAPRFDAAPSVASKSAAIGYAMQMEFLGRRDPVR
FT                   APQVVTAWTADRDLTNPALPAFQVCVLLSKLQLNELQQSLKLIVDAAKRTQTSPKDFFQ
FT                   EIASASAYMSRDPAQLVKGSNLAQSGVLGEYLEGLPYRSKSLNMTQDLWLSLSVAEQQD
FT                   FIDELESKIRLYETFHNDVANWVRFGDADAGDALYRVPLSTLP"
     atggacatag aacttccggg attcgacatc gaacgcgagc tgggcgaagg cgccatggcc        60
     acggtctacc tggccaccca gcgctcgctg cagcgcaagg tggcgctgaa ggtgatggcc       120
     gcggcgctgg ccgccgaccc gagcttcgcc gaacgcttcc tgcgcgaagg tcggaccctg       180
     gcgcggctgt cgcacccgaa cacggtgacc atccacgaca tcggcaacgt cggcagttgc       240
     tactacatgg ccatggaata cctgcccaac ggcacgctca aggagcgcat ccagcagggc       300
     ctcgatcccg agcagggcct ggcctacgta cggcaggtgg ccgccgcgct cggctacgcg       360
     cactcccagg gcctggtgca tcgcgacgtg aagccggcca acatcctgtt ccgcgccgac       420
     ggcaccgcgg tgctctcgga cttcggcatc gccaagtcga tcgaggacaa tacccagttc       480
     acccaggtcg gcttcgccgt cggcaccccc agctacatga gcccggagca ggcccgcggg       540
     caggagatcg acggccgcgc cgacctctac gcgctgggcg tggtgctcta cgagatcctc       600
     accggcaagc tgccctacaa cggcaaggac tcgctctcca ccgccctggc ccacctcacc       660
     gagccgctgc cggaactgcc gatcgagcag ggccgctacc aggacatcct gcgccagttg       720
     ctggccaagg acccggccga gcgcttcccc accgccggcg cgttgatcgc cgccctcgac       780
     cgcctggcgc cgagcgccct ggaagccacc cagatccgtc cgctggcgac gccgcagggc       840
     tcgccgcgag cgagcaaccc gccgccggcc gaacccgcgc ccctgccgcc cgccgacctc       900
     ggcggcctgc aaccggtgtc gatccagttg ccgccggtca cgcccagcgc cggcggcgcc       960
     acgccgcctc cgcctccgcc gtcgcaagcg gcgaaaccgc catcgccccc gccgcctccg      1020
     ttgccgccgg cgaagccacg tgccggcggc agccgcacgc cgttgatcgc cgccgccgcg      1080
     gccgccgtgc tcctggcgat cggcggcggc gcctggtggc tgctgggctc ggacgacgca      1140
     ccgagccctg tcgatccagc gccgctggga cagacgccga cggacaagcc gcagcagcag      1200
     accccagtgg ccgatgccga acaggacggc ggcgagcgtc cgctgctgat gccgggcaag      1260
     aagacgctgt tccagcgcgt cctgaccaaa cccggcgcgg ccatctccgc cgaggctggc      1320
     ggcccgcccc gggccggcgc ggtgccggcc ttctcggtgc tctacgtgta cgcccgcaag      1380
     caggtcggcg gcagcccctg gctgcgcgtc ggcgcctcca gcaacggcga gggcgacggc      1440
     tggctgccgg ccagcgcggt gagcgactgg aagcagagcc tggtgctgaa gttcaccgaa      1500
     cgctccggcc gcgcgccggt gatgttcctc aacagcgccg agcaggtcga acgcctgctc      1560
     ggcgataccc gcgcggcgcg cgacaccctg acccaggcgg tggaccacaa gggcgatccg      1620
     caggtggtcg cggtcgagcc caacgaccgg gcgatccccc aggaccagtt ctacctgctg      1680
     ccgatcttcg actcgaagga gagcttcgac gccgacggcc agccggcgca gttgctggag      1740
     gtcgcttcga tcgaccccgg cggcagcgcc acggcacccc aggcgccggg ccaggccggg      1800
     cggggcggcg ccagcggcgc ggcgagcgac accttccgca ccggcatcgt cctggtggtg      1860
     gacacctcgg tgtcgatgca gccctacatc gaccgcgtgc gcgaggtgat cgacggcctg      1920
     cagcggcaga tcggcgagcg cggcgacctg gacaaggtca gcttcggcct ggtcggcttc      1980
     cgcaacaaca ccgacaagac ccccggcctg gaatacgtca gcaagaccct ggtgccgctg      2040
     caaccgggca acgacgcgca gcgcttcgcc gagttgagca gccaggtgcg cgccaccgac      2100
     gtctccagcc actcgttcaa cgaagacgcc ttcgccggga tcatgcaggc ggtcgacgaa      2160
     atggactggt cgccctacgc cgggcgcgtg gtgctgctgg tcaccgacgc cggcgcgctg      2220
     cgcaagaacg acccgctcgg gcgcacccag atgaacgagg ccgaggtccg ccaggcggcg      2280
     ctgcgcaagg gcgtgaagat ctatgccctg cacctgcgca ccccggccgg gaagaacaac      2340
     cacggctacg ccgagcagca gtaccgcagc ctcaccgccg acgccaaccc gaagatcgcc      2400
     gacctctaca tcccggtggc cggcggcgag gtgaacgcct tcggcaacac ggtgaaggag      2460
     atcggcacgg tgttcgccga cctggtccac gacgccggca accgcaagcc gcaggcgccg      2520
     cgcttcgacg ccgcgccaag cgtggcgagc aagtcggcgg ccatcggcta cgccatgcag      2580
     atggaattcc tcggtcgccg cgacccggtg cgcgcgccgc aggtcgtcac cgcctggacc      2640
     gccgaccgcg acctgaccaa cccggcgctg ccggcgttcc aggtctgcgt gctgctgagc      2700
     aagctgcaac tcaacgaact gcaacagtcg ctgaaactga tcgtcgacgc ggccaagcgc      2760
     acccagacct cgcccaagga cttcttccag gaaatcgcca gcgccagcgc ctacatgagc      2820
     cgcgacccgg cgcaactggt gaagggcagc aacctggcgc agagcggcgt gctcggcgaa      2880
     tacctggaag gcctgccgta ccgcagcaag tcgctgaaca tgacccagga cctctggctg      2940
     tcgctgagcg tcgccgaaca gcaggacttc atcgacgaac tggagtcgaa gatccgcctc      3000
     tacgaaacct tccacaacga cgtcgccaac tgggtccggt tcggcgacgc cgacgccggc      3060
     gacgcgctgt accgcgtgcc gctgtcgacg ctgccatga                             3099
//

If you have problems or comments...

PBIL Back to PBIL home page