(data stored in ACNUC7421 zone)

EMBL: CP000438.PRKA

CP000438.PRKA        Location/Qualifiers
FT   CDS_pept        complement(659551..661473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prkA"
FT                   /locus_tag="PA14_07680"
FT                   /product="putative protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07680"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15552"
FT                   /db_xref="GOA:A0A0H2ZKX3"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKX3"
FT                   /protein_id="ABJ15552.1"
FT                   /translation="MSIFSHFQERFEATRQEEYSLQEYLDLCKQDKTAYASAAERLLMA
FT                   IGEPELLDTSVDSRLSRIFSNKVIRRYPAFADFHGMEECIDQIVAFFRHAAQGLEEKKQ
FT                   ILYLLGPVGGGKSSLAEKLKQLMEKVPFYAIKGSPVFESPLGLFNPDEDGAILEEDYGI
FT                   PRRYLRSIMSPWATKRLNEFGGDISQFRVVKLYPSILNQIAIAKTEPGDENNQDISALV
FT                   GKVDIRKLEEYPQNDADAYSYSGALCRANQGLMEFVEMFKAPIKVLHPLLTATQEGNYN
FT                   STEGLGALPYSGIILAHSNESEWHSFRNNKNNEAFIDRIYIVKVPYCLRVADEIKIYDK
FT                   LLVNSSLAHAHCAPDTLKMLSQFSVLSRLKEPENSNIYSKMRVYDGENLKDTDPKAKSI
FT                   QEYRDSAGVDEGMAGLSTRFAFKILSKVFNFDPHEVAANPVHLLYVLEQQIEQEQFQPE
FT                   TRERYLRFIKEYLAPRYVEFIGKEIQTAYLESYSEYGQNIFDRYVLYADFWIQDQEYRD
FT                   PETGEILNRAALNEELEKIEKPAGISNPKDFRNEIVNFVLRARAGNNGKNPSWLSYEKL
FT                   RVVIEKKMFSNTEDLLPVISFNAKASKEDQQKHNDFVKRMVERGYTEKQVRLLSEWYLR
FT                   VRKSQ"
     atgagcattt tcagtcactt ccaggaacgc ttcgaagcga cccgccaaga ggaatattcc        60
     ctccaggaat atctcgacct ctgcaagcaa gacaagacag cctatgcctc cgccgccgag       120
     cgcctgctga tggcgatcgg cgagccggag ttgctggaca cctcggtgga ctccaggctg       180
     tcgcggatct tctccaacaa ggtgattcgc cgctacccgg cgttcgccga cttccacggc       240
     atggaggaat gcatcgacca gatcgtcgcg tttttccgcc acgcggccca gggcctggag       300
     gagaagaagc agatccttta cctgctcggc ccggtcggcg gcggtaaatc ctccctggcg       360
     gaaaaactca agcaactcat ggagaaggtg cccttctacg cgatcaaggg ctcgccggtc       420
     ttcgagtcgc cgctgggctt gttcaacccc gacgaagacg gcgccatcct cgaggaggac       480
     tacggcatcc cgaggcgcta cctgcgctcg atcatgtcgc cctgggcaac caagcgcctc       540
     aacgaattcg gcggcgacat cagccagttc cgcgtggtca agctgtaccc ctcgatcctc       600
     aaccagatcg ccatcgccaa gaccgagccc ggcgacgaga acaaccagga catatccgcg       660
     ctggtcggca aggtcgacat ccgcaagctg gaggaatacc cgcagaacga cgcggacgcc       720
     tacagctatt cgggcgccct ctgccgggcc aaccagggcc tgatggaatt cgtcgagatg       780
     ttcaaggccc cgatcaaggt cctgcacccg ctgctgaccg cgacccagga aggcaactac       840
     aacagcaccg aaggcctcgg tgccctgccc tacagcggca tcattctggc tcactccaac       900
     gagtcggaat ggcacagctt ccgcaacaac aagaacaacg aggccttcat cgaccgcatc       960
     tacatcgtca aggtgccgta ctgcctgcgc gtggcggacg agatcaagat ctacgacaag      1020
     ttgctggtca acagctcgct ggcgcatgcc cactgcgcgc cggacaccct gaagatgctc      1080
     tcgcagttct ccgtgctgtc gaggctgaaa gagccggaaa actcgaatat ctactcaaag      1140
     atgcgggtat atgacggcga aaacctgaaa gataccgatc ccaaggccaa gtcgatccag      1200
     gaataccgcg actcggccgg ggtcgacgaa ggcatggccg ggctttccac ccgcttcgcc      1260
     ttcaagatcc tctccaaggt attcaacttc gacccgcacg aggtagcggc caacccggtg      1320
     cacctgctct acgtcctcga acagcagatc gagcaggaac agttccagcc ggaaacccgc      1380
     gagcgctacc tgcgtttcat caaggaatac ctggcgccgc gctacgtcga gttcatcggc      1440
     aaggaaatcc agaccgccta cctggagtcc tacagcgaat acggtcagaa catcttcgac      1500
     cgctatgtgc tgtacgccga cttctggatc caggaccagg aataccgcga cccggaaacc      1560
     ggcgagatcc tcaaccgcgc cgctctcaac gaggaactgg agaagatcga gaaacccgcc      1620
     ggcatcagca acccgaagga cttccgcaac gagatcgtca acttcgtgct gcgcgcccgc      1680
     gccggcaaca acggcaagaa cccgagctgg ctgtcctacg agaagctgcg cgtagtgatc      1740
     gagaagaaga tgttctccaa caccgaggac ctgcttccgg tcatcagctt caacgccaag      1800
     gccagcaagg aggaccagca gaagcacaac gacttcgtca aacgcatggt cgagcgcggc      1860
     tacaccgaga agcaggtccg cctgctgtcg gaatggtacc tgcgggttcg caagtcgcag      1920
     tag                                                                    1923
//

If you have problems or comments...

PBIL Back to PBIL home page