(data stored in ACNUC7421 zone)

EMBL: CP000438.PTSP

CP000438.PTSP        Location/Qualifiers
FT   CDS_pept        392770..395049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsP"
FT                   /locus_tag="PA14_04410"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04410"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15301"
FT                   /db_xref="GOA:A0A0H2ZKE1"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE1"
FT                   /protein_id="ABJ15301.1"
FT                   /translation="MLNTLRKIVQEVNSAKDLKAALGIIVQRVKEAMGTQVCSVYLLDT
FT                   ETQRFVLMATEGLNKRSIGKVSMAPSEGLVGLVGTREEPLNLENAAAHPRYRYFAETGE
FT                   ERYASFLGAPIIHHRRVMGVLVVQQKERRQFDEGEEAFLVTMSAQLAGVIAHAEATGSI
FT                   RGLGKLGKGIQEAKFVGVPGAPGVGVGKAVVVLPPADLEVVPDKQVDDIDAEIALFKQA
FT                   LEGVRADMRALSSKLASQLRKEERALFDVYLMMLDDASIGNEVKRIIRTGQWAQGALRQ
FT                   VVMEHVQRFELMDDAYLRERASDVKDIGRRLLAYLQEERKQNLTYPEQTIIVSEELSPA
FT                   MLGEVPEGRLVGLVSVLGSGNSHVAILARAMGIPTVMGAVDLPYSKVDGIDLIVDGYHG
FT                   EVYTNPSAELVRQYSDVVAEERELSKGLAALRELPCETLDGHRMPLWVNTGLLADVARA
FT                   QERGAEGVGLYRTEVPFMINDRFPSEKEQLAIYREQLSAFHPLPVTMRTLDIGGDKALS
FT                   YFPIKEDNPFLGWRGIRVTLDHPEIFLVQTRAMLKASEGLDNLRILLPMISGTHELEEA
FT                   LHLIHRAWGEVRDEGVDIAMPPIGMMVEIPAAVYQTRELARQVDFLSVGSNDLTQYLLA
FT                   VDRNNPRVADLYDYLHPAVLHALKKVVDDAHLEGKPVSICGEMAGDPAAAVLLMAMGFD
FT                   SLSMNATNLPKVKWLLRQITLDKARDLLGQLLTFDNPQVIHSSLHLALRNLGLGRVINP
FT                   AATVQP"
     atgctcaaca cgctgcgcaa gatcgtccag gaagtgaact ccgccaagga tctgaaggcg        60
     gcgctgggca tcatcgtgca gcgggtcaag gaagccatgg gtacccaggt ctgctcggtg       120
     tacctgctcg acaccgagac ccagcgtttc gtcctgatgg ccaccgaagg cctcaacaag       180
     cgttccatcg gcaaggtcag catggccccc agcgaaggcc tggtcggcct ggtcggcacc       240
     cgcgaggagc cgctcaacct ggagaacgcc gccgcccacc cgcgctaccg ctatttcgcc       300
     gagaccggcg aggagcgcta cgcgtcgttc ctcggcgcgc cgatcatcca ccataggcgg       360
     gtgatggggg tgctggtggt gcagcagaag gagcgccgcc agttcgacga aggcgaggag       420
     gccttcctcg tcaccatgag cgcccagctc gccggggtca tcgcgcatgc cgaggcgacc       480
     ggttcgatcc gcggcctggg caagctcggc aagggcatcc aggaagccaa gttcgtcggc       540
     gtgcccggcg cccccggggt cggggtgggc aaggcggtgg tggtgttgcc tccggccgac       600
     ctggaagtgg tgccggacaa gcaggtcgac gacatcgacg ccgagatcgc cctgttcaag       660
     caggccctgg agggcgttcg cgccgacatg cgcgcgctgt cgagcaagct cgccagccag       720
     ttgcgcaagg aagaacgcgc gctgttcgac gtctacctga tgatgctcga cgatgcctcc       780
     atcggcaacg aggtcaagcg catcatccgt accggccagt gggcccaggg cgccctgcgc       840
     caggtggtga tggagcacgt gcagcgcttc gagctgatgg acgacgccta tctccgcgag       900
     cgcgcctccg acgtcaagga catcggtcgc cgcctgctcg cctacctgca ggaagaacgc       960
     aagcagaacc tgacctaccc ggagcagacc atcatcgtca gcgaggagct gtcgccggcg      1020
     atgctcggcg aggtgccgga agggcgcctg gtcggcctgg tctcggtgct cggctcgggc      1080
     aactcgcacg tggcgatcct cgcccgtgcc atgggcatcc ccacggtgat gggggcggtc      1140
     gacctgccgt actccaaggt cgacggtatc gacctgatcg tcgatggcta ccacggcgag      1200
     gtctacacca acccctccgc cgagctggtg cgccagtaca gcgacgtggt cgccgaggag      1260
     cgcgagctga gcaagggcct ggcggccctg cgcgagctgc cctgcgagac cctcgacggc      1320
     caccgcatgc cgctctgggt caacaccggc ctgctcgccg atgtcgcccg cgcccaggag      1380
     cgtggcgccg agggcgtggg cctgtaccgc accgaagtgc cgttcatgat caacgaccgc      1440
     ttccccagcg agaaggaaca gctggcgatc taccgcgagc agctcagtgc cttccacccg      1500
     ctgccggtga ccatgcgcac cctggatatc ggcggcgaca aggcgctgtc ctacttcccg      1560
     atcaaggaag acaacccgtt cctcggctgg cgcggcatcc gcgtcaccct cgaccacccg      1620
     gagatcttcc tggtccagac ccgcgccatg ctcaaggcca gcgaaggact ggacaacctg      1680
     cgcatcctgc tgccgatgat ctccggcacc cacgagctgg aagaggccct gcacctgatc      1740
     caccgcgcct ggggcgaggt gcgcgacgag ggcgtggaca tcgccatgcc gcctatcggc      1800
     atgatggtcg agattcccgc cgccgtgtac cagacccgcg agctggcccg tcaggtcgac      1860
     ttcctttcgg tcggttcgaa cgacctgacc cagtacctgc tggcggtcga ccgcaacaat      1920
     ccgcgggtcg ccgacctcta cgactacctg catccggccg tgctgcatgc gttgaagaag      1980
     gtggtcgacg atgcccacct ggaaggcaag ccggtgagca tctgcggcga gatggccggc      2040
     gatcccgcgg ctgccgtgct gctgatggcg atgggcttcg acagcctgtc gatgaacgcc      2100
     accaacctgc ccaaggtgaa gtggctgctg cgccagatca ccctggacaa ggcccgggac      2160
     ctgctcggcc agttgctcac cttcgacaac ccgcaggtca tccacagctc gctgcacctg      2220
     gcgttgcgca acctcggcct gggtcgcgtg atcaacccgg cggctaccgt ccagccctga      2280
//

If you have problems or comments...

PBIL Back to PBIL home page