(data stored in ACNUC7421 zone)

EMBL: CP000438.PYRC

CP000438.PYRC        Location/Qualifiers
FT   CDS_pept        complement(458157..459428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /gene_synonym="pyrX"
FT                   /locus_tag="PA14_05250"
FT                   /product="noncatalytic dihydroorotase-like protein
FT                   noncataly"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05250"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15368"
FT                   /db_xref="GOA:A0A0H2ZL93"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL93"
FT                   /protein_id="ABJ15368.1"
FT                   /translation="MTISIRGARVIDPASGLDQVGDLHIEAGKIVAIGAAPAGFSAQKT
FT                   LDGAGLVAAPGLVDLSVALREPGYGRKGNVESETRAAAAGGTTSLCCPPYTRPVLDTPA
FT                   VAELILDRAREAGNAKVYPIGALTRGFGGEQLSELVALRDTGCVAFTNGLHGFASNRIL
FT                   RRALEYAATFDLTVIFTSQDTDLAEGGLAHEGPTASFLGLAGIPETAETVALARNLLLV
FT                   EQSGVRAHFSQLTSARGIELVAQAQARGLPVTCDVALYQLILTDEALVGFSSLYHVQPP
FT                   LRTKADREALREAVKNGVVQAIASHHQPHEADAKNAPFAATEPGISGAELLLPLAMTLV
FT                   QDGLLDLPTLLARLSHGPAQALRLPAGRLAVGQAADLVLFDPQGSTLAGESWYSKGQNS
FT                   PFVGHCLPGRVRYTLVDGHLTHEG"
     atgaccatca gtatccgagg cgcccgcgtc atcgacccgg ccagcggcct ggaccaggtc        60
     ggcgacctcc acatcgaggc cggcaagatc gtcgccatcg gcgccgcgcc ggccggcttc       120
     agcgcccaga agaccctcga cggcgccggc ctggtggccg cgccgggact ggtcgacctc       180
     agcgtcgccc tgcgcgagcc gggctacgga cgcaagggca acgtcgaaag cgagacccgc       240
     gccgccgcgg ccggcggcac caccagcctg tgctgcccgc cctatacccg gccggtgctg       300
     gacaccccgg cggtggccga gctgatcctc gaccgggccc gtgaggccgg caacgccaag       360
     gtctacccca tcggcgcgct gacccgcggc ttcggcggcg agcaactgtc ggaactggtg       420
     gccctgcgcg acaccggttg cgtggccttc accaatggcc tgcatggctt cgccagcaac       480
     cgcatcctgc ggcgcgccct ggagtacgcg gcgaccttcg acctgacggt gatcttcacc       540
     tcgcaggaca ccgatctcgc cgaaggcggc ctcgcccacg aaggcccgac tgccagcttc       600
     ctcggcctcg cggggatccc ggaaaccgcc gagaccgtgg ccctggcccg caacctgctg       660
     ctggtggaac agagcggcgt gcgcgcgcac ttcagccagt tgaccagcgc ccgcggcatc       720
     gaacttgtcg cccaggccca ggcccgcggc ctgccggtga cctgcgacgt ggcgctgtac       780
     cagttgatcc tcaccgacga agcgctggtg ggcttctcca gcctctacca cgtgcaaccg       840
     ccgctgcgca ccaaggccga ccgcgaagcc ctgcgcgagg cggtgaagaa cggcgtggta       900
     caagccatcg ccagccacca ccaaccccac gaggcggacg ccaagaacgc gccgttcgcc       960
     gccaccgagc cgggcatcag cggcgccgag ctgctgctgc cgctggcgat gacgctggtg      1020
     caggacggcc tgctcgacct gccgaccctg ctcgcccgcc tctcccacgg cccggcccag      1080
     gcgctgcgcc tgcctgccgg gcgcctggcg gtgggccagg ccgccgacct ggtgctgttc      1140
     gacccgcagg gttcgaccct ggccggtgag agctggtact cgaaggggca gaacagcccg      1200
     ttcgtcggtc actgcctgcc gggacgagtg cgttacaccc tggtggacgg acacctgacc      1260
     cacgagggct ga                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page