(data stored in ACNUC7421 zone)

EMBL: CP000438.RECF

CP000438.RECF        Location/Qualifiers
FT   CDS_pept        3169..4278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="PA14_00030"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14959"
FT                   /db_xref="GOA:Q02V78"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02V78"
FT                   /protein_id="ABJ14959.1"
FT                   /translation="MSLTRVSVTAVRNLHPVTLSPSPRINILYGDNGSGKTSVLEAIHL
FT                   LGLARSFRSARLQPVIQYEEAACTVFGQVMLANGIASNLGISRERQGEFTIRIDGQNAR
FT                   SAAQLAETLPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFLPVWQRLQKALRQRN
FT                   SWLRHGKLDPASQAAWDRELSLASDEIDAYRRSYIQALKPVFEETLAELVSLDDLTLSY
FT                   YRGWDKDRDLLEVLASSLLRDQQMGHTQAGPQRADLRIRLAGHNAAEILSRGQQKLVVC
FT                   ALRIAQGHLINRAKRGQCVYLVDDLPSELDEQHRMALCRLLEDLGCQVFITCVDPQLLK
FT                   DGWRTDTPVSMFHVEHGKVSQTTTIGSEA"
     atgtccctga cccgcgtttc ggtcaccgcg gtgcgcaacc tgcacccggt gaccctctcc        60
     ccctcccctc gcatcaacat cctctacggc gataatggca gcggcaagac cagtgtgctc       120
     gaagccatcc acctgctggg cctggcgcgt tcattccgca gtgcgcgctt gcagccggtg       180
     atccagtatg aggaagcggc ctgcaccgta ttcggccagg tgatgttggc caacggcatc       240
     gccagcaacc tggggatttc ccgtgagcgc cagggcgagt tcaccatccg catcgatggg       300
     cagaacgccc ggagtgcggc tcaattggcg gaaactctcc cactgcaact gatcaacccg       360
     gacagctttc ggttgctcga gggagcgccg aagatccgcc gacagttcct cgattgggga       420
     gtgttccacg tggaacctcg gtttctgccc gtctggcagc gcctgcagaa ggcgctgcgc       480
     cagcggaact cctggctccg gcatggtaaa ctggaccccg cgtcgcaagc ggcctgggac       540
     cgggaattga gcctggccag cgatgagatc gatgcctacc gcagaagcta tatccaggcg       600
     ttgaaaccgg tattcgagga aacactcgcc gaattggttt cactggatga cctgaccctt       660
     agctactacc gaggctggga caaggaccgg gacctcctgg aggttctggc ttccagcctg       720
     ttgcgcgacc agcagatggg ccacacccag gcgggaccgc agcgtgcgga tcttcgcata       780
     cggttggcag gtcataacgc cgcggagatt ctctcgcgcg gtcagcagaa gctggtggta       840
     tgcgccctgc gcatcgccca aggccatctg atcaatcgcg ccaagcgcgg acagtgcgtc       900
     tacctggtgg acgacctgcc ctcggaattg gatgagcagc atcgaatggc tctttgccgc       960
     ttgcttgaag atttgggttg ccaggtattc atcacctgcg tggacccgca actattgaaa      1020
     gacggctggc gcacggatac gccggtatcc atgttccacg tggaacatgg aaaagtctct      1080
     cagaccacga ccatcgggag tgaagcatga                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page