(data stored in ACNUC7421 zone)

EMBL: CP000438.SBP

CP000438.SBP         Location/Qualifiers
FT   CDS_pept        complement(330946..331944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbp"
FT                   /locus_tag="PA14_03700"
FT                   /product="sulfate-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03700"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15246"
FT                   /db_xref="GOA:A0A0H2ZKY4"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKY4"
FT                   /protein_id="ABJ15246.1"
FT                   /translation="MSLRRFALAALASALVSGPVAAATQLLNVSYDPTRELYQAYNAAF
FT                   IKHWKAQGGEDLTVQQSHGGSGKQARAVIDGLKADVVTLALAGDIDELHKLGKLLPADW
FT                   QARLPDNSTPYTSTIVFLVRKGNPKGIKDWGDLTKEGVEVITPNPKTSGGARWNFLAAW
FT                   AWAKKQYGSDEKAKDYVQALYKHVPVLDTGARGSTITFVNNQIGDVLLAWENEAFLAKK
FT                   EQGGENFEIVVPSISILAEPPVAVVDKVVEKKGTRKVAEAYLQYLYSEEGQRIAAQNFY
FT                   RPRNQKVAAEFATQFPKLNLVTVDSDFGGWKTAQPKFFNDGGIFDQIYQAQ"
     atgtcccttc gtcgtttcgc cctggccgca ctcgccagcg ccctggtctc cggcccggtt        60
     gccgcggcca cgcaactgct gaacgtttcc tacgacccga cccgcgagct gtaccaggcc       120
     tacaacgcgg ccttcatcaa gcactggaag gcccagggcg gcgaggacct gaccgtccag       180
     cagtcccacg gaggctccgg caagcaggcc cgcgcggtga tcgacgggct caaggccgac       240
     gtggtgaccc tggccctggc cggcgacatc gacgaactgc acaagctcgg caagctgctg       300
     ccggccgact ggcaggcacg cctgccggac aacagcaccc cctacacctc gaccatcgtg       360
     ttcctggtgc gcaagggcaa ccccaaggga atcaaggact ggggcgacct gaccaaggaa       420
     ggcgtggaag tcatcacgcc gaacccgaag acctccggcg gcgcgcgctg gaacttcctc       480
     gccgcctggg cctgggcgaa gaagcagtac ggcagcgacg agaaggccaa ggactacgtg       540
     caggcgctgt acaagcacgt accggtgctc gacaccggcg cccgcggctc gaccatcacc       600
     ttcgtcaaca accagatcgg cgacgtgctg ctggcctggg agaacgaggc gttcctggcg       660
     aagaaggaac agggcgggga aaacttcgag atcgtcgtac cctccatctc catcctcgcc       720
     gaaccaccgg tcgcggtggt cgacaaggtg gtcgagaaga aaggcacccg caaggtcgcc       780
     gaggcctacc tgcaatacct gtacagcgag gaaggccagc gcatcgccgc gcagaacttc       840
     taccggccgc gcaaccagaa ggtcgccgcc gagttcgcca cgcagttccc gaaactgaac       900
     ctggtcaccg tcgactccga tttcggcggc tggaagacgg cccagccgaa gttcttcaac       960
     gacgggggca tcttcgacca gatctaccag gcgcaatga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page