(data stored in ACNUC7421 zone)

EMBL: CP000438.SMF

CP000438.SMF         Location/Qualifiers
FT   CDS_pept        22893..23981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smf"
FT                   /locus_tag="PA14_00230"
FT                   /product="putative Rossmann fold nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14977"
FT                   /db_xref="GOA:A0A0H2ZIX1"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZIX1"
FT                   /protein_id="ABJ14977.1"
FT                   /translation="MKNHSPAELEARLRLHGLPELGPMRFLRLIEAFGSASSALAAPAG
FT                   AWRTLGVPAEAAAARRSPAVREAAGEALRWLEGPRRHLLMWDDPGYPALLAEVADAPPL
FT                   LYVEGAPETLERPQLAMVGSRRASPAGLGTARSFARSLAQGGFAITSGLALGIDGAAHE
FT                   GALEVGGVTVAVLGTGLRRLYPRRHEALARRIVEGGGALVSELPLDSPPLPANFPRRNR
FT                   IISGLSLGVLVVEASPASGSLITARLAAEQGREVYAIPGSIHHPGARGCHQLIRDGALL
FT                   VESVGHVLEALRGWAQAEPAEAPAQPLPHPLLALLRAAPYTSEGLAAASGMTLPDVLAT
FT                   LSELELDGRVACEAGTWVHRSG"
     atgaagaacc attctccagc cgaactggaa gcacggctgc gcctgcatgg cctgcccgaa        60
     ctggggccca tgcgcttcct gcgcttgatc gaggccttcg gttcggcctc ttccgcgctt       120
     gccgcgccag ccggcgcctg gcgcaccctg ggagtgcctg ccgaggccgc tgccgcgcgg       180
     cgcagcccgg cggtgcggga agcggcgggt gaagccctgc gctggctgga aggtccgcgc       240
     aggcacctgc tgatgtggga cgacccggga tacccggcac tgctcgccga agtcgccgat       300
     gccccgccgc tgctgtacgt cgaaggcgct ccggagactc tggaacggcc gcaactggcg       360
     atggtcggca gccgccgcgc cagccccgcc gggctgggca ccgcccggag ctttgcgcgc       420
     agcctggcgc agggcggctt cgccatcacc agcgggctgg ccctgggcat cgatggcgcc       480
     gcccacgagg gcgcgctgga ggttggcggc gtgaccgtgg cagtcctcgg caccggcctg       540
     cgcaggctct atccgcgccg ccacgaggcg ctggcgcggc gcatcgtcga gggtggcggc       600
     gcgctggttt cggaactgcc gctggacagc ccgccgctgc cggcaaactt tccccggcgc       660
     aaccgcatca tcagcggact ctcgctgggt gtgctggtgg tcgaggcaag tcccgccagc       720
     ggctcgctga tcaccgcgcg gctggcggcg gaacagggtc gcgaggtata cgccatcccg       780
     ggctccatcc accaccccgg cgcacgtggc tgccaccagc tgattcgcga tggcgcgctg       840
     ctggtggaaa gcgtcgggca cgtgctcgaa gcactgcgcg gctgggcgca ggcggagcca       900
     gcggaagcgc cggcgcaacc cctgccccac cctttgctgg cgctgctgcg cgccgcgccc       960
     tacaccagcg aaggcctggc cgccgccagc ggcatgacgc tgcccgacgt gctggcgacg      1020
     ctcagcgaac tggaactcga cggccgggtc gcctgcgagg ccggcacctg ggtgcatcgc      1080
     tccggctga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page