(data stored in ACNUC7421 zone)

EMBL: CP000438.SPUD

CP000438.SPUD        Location/Qualifiers
FT   CDS_pept        352562..353665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuD"
FT                   /locus_tag="PA14_03920"
FT                   /product="polyamine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03920"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15262"
FT                   /db_xref="GOA:Q02UB7"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02UB7"
FT                   /protein_id="ABJ15262.1"
FT                   /translation="MMKRFGKTLLALTLAGSVAGMAQAADNKVLHVYNWSDYIAPDTLE
FT                   KFTKETGIKVVYDVYDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKL
FT                   PNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLVFK
FT                   PENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFH
FT                   SSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPK
FT                   DAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMK
FT                   KLYTFPDLPAKTQRAMTRSWTKIKSGK"
     atgatgaaac gtttcggtaa gaccctgctc gccctgacct tggcgggctc tgtggccggt        60
     atggcgcagg ctgcggacaa caaggtactg cacgtgtaca actggtccga ctacatcgcg       120
     ccggacaccc tggagaagtt caccaaggaa accgggatca aggtcgtcta cgacgtctac       180
     gacagcaacg aagtgctgga agccaagttg ctggcgggca agtccgggta cgacgtggtg       240
     gtgccgtcca actccttcct cgccaagcag atcaaggccg gggtctacca gaagctcgac       300
     aagtccaagc tgccgaactg gaagaacctg aacaaggacc tgatgcacac cctggaagtc       360
     agcgacccgg gcaacgagca tgcgattccc tacatgtggg gcaccatcgg catcggctac       420
     aacccggaca aggtcaaggc ggccttcggc gacaatgcgc cggtggattc ctgggacctg       480
     gtattcaagc cggagaacat ccagaagctg aagcagtgcg gcgtcagctt cctcgactcg       540
     ccgaccgaga ttctcccggc ggccctgcac tatctcggct acaagccgga caccgacaat       600
     cccaaggaac tcaaggcggc cgaagagctg ttcctgaaga tccgtcccta cgtcacctac       660
     ttccactcgt cgaagtacat ttccgacctg gccaacggca acatctgcgt cgccatcggc       720
     tactccggcg acatctacca ggccaagtcc cgcgccgaag aggcgaagaa caaggtcacc       780
     gtcaagtaca acattcccaa ggaaggcgcc ggcagcttct tcgacatggt cgccattccc       840
     aaggacgccg agaacaccga gggcgccctg gccttcgtca acttcctgat gaagccggaa       900
     atcatggccg agatcaccga cgtggttcag ttccccaacg gcaacgcagc ggccaccccg       960
     ctggtgtccg aggcgatccg caacgacccg ggcatctacc cgagcgaaga ggtcatgaag      1020
     aagctgtata ccttccccga cctgccggcc aagacccagc gggcgatgac ccgcagctgg      1080
     accaagatca agtccggcaa gtga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page