(data stored in ACNUC7421 zone)

EMBL: CP000438.SPUE

CP000438.SPUE        Location/Qualifiers
FT   CDS_pept        354084..355181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuE"
FT                   /gene_synonym="potF2"
FT                   /locus_tag="PA14_03930"
FT                   /product="polyamine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03930"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15263"
FT                   /db_xref="GOA:A0A0H2ZL00"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL00"
FT                   /protein_id="ABJ15263.1"
FT                   /translation="MQHSIGKTLLVAALATAIAGPVQAEKKSLHIYNWTDYIAPTTLKD
FT                   FTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLP
FT                   NWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPE
FT                   NMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSS
FT                   KYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADA
FT                   KAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKL
FT                   YVSAVLPAKVLRLQTRTWTRIKTGK"
     atgcaacatt ccattggcaa gacactgctg gtagccgctc tggctacggc gatcgcgggc        60
     cccgtgcagg cggagaagaa gagcctgcac atctataact ggaccgatta catcgctccc       120
     accaccctca aggacttcac caaggagagc gggatcgacg tcagctacga cgtcttcgac       180
     tccaacgaga ccctcgaggg caagctggtc tccggccact ccggctatga catcgtggtg       240
     ccgtcgaaca acttcctcgg caagcagatc caggccggtg ccttccagaa gctggacaag       300
     agcaagctgc cgaactggaa gaacctcgat ccggcgctgc tcaagcaact ggaggtcagc       360
     gacccgggca accagtacgc ggttccctac ctgtggggca ccaacggcat cggttacaac       420
     gtggccaagg tcaaggaagt cctcggcgac cagccgatcg actcctgggc catcctcttc       480
     gagccggaga acatgaagaa gctcgccaag tgcggcgtag ccttcatgga cagcggcgac       540
     gagatgctgc ccgccgccct caactacctg gggctggacc ccaacaccca cgacccgaag       600
     gactacaaga aggccgagga agtcctgacc aaggttcgcc cctacgtcag ctacttccac       660
     tcctccaagt acatctccga cctggccaac ggcaacatct gcgtcgcctt cggctattcc       720
     ggggacgtct tccaggccgc tgcccgcgcc gaagaggccg gcaagggcat cgacatccag       780
     tacgtgattc ccaaggaagg cgccaacctg tggttcgacc tgatggcgat tcccgccgat       840
     gccaaggccg ccgataacgc ctatgcgttc atcgactacc tgctgcgtcc ggaggtgatc       900
     gccaaggtca gcgactacgt cggctacgcc aacgcgatac cgggggcccg cccgctgatg       960
     gacaagagcg tcagcgacag cgaggaggtg tatccgccgc aggccgtgct cgacaagctc      1020
     tacgtttccg ccgtgttgcc ggccaaggtg ctgcgcctgc agacccgtac ctggacccgg      1080
     atcaagaccg gcaaataa                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page