(data stored in ACNUC7421 zone)

EMBL: CP000438.SPUF

CP000438.SPUF        Location/Qualifiers
FT   CDS_pept        355236..356390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuF"
FT                   /gene_synonym="potG"
FT                   /locus_tag="PA14_03940"
FT                   /product="polyamine transport protein PotG"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03940"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15264"
FT                   /db_xref="GOA:A0A0H2ZKB1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKB1"
FT                   /protein_id="ABJ15264.1"
FT                   /translation="MAIASGAYKKALEGNQQPKEVLVKIDRVTKQFDETLAVDTVSLTI
FT                   NKGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIFLDGQDITDLPPYERPINMMFQSYA
FT                   LFPHMSVAQNIAFGLKQDGLPKAEIDERVAEMLKLVHMTQYAKRKPHQLSGGQRQRVAL
FT                   ARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGVTCVMVTHDQEEAMTMAQR
FT                   IAIMHLGCIEQIGSPMDIYETPASRLVCEFIGNVNLFDGVLVEDVQDHAVIACPQLENP
FT                   IYIGHGISTRAEDKRITYALRPEKVMISAQKPDNLEHAGHNWAQGTVYDIAYLGGHSVY
FT                   YIKLASGMIVQAFMANAERHVARPTWDQSVYISWYDDSGVVLQS"
     atggcgatag cctccggtgc ctacaagaaa gccctagagg gcaaccagca gccgaaagag        60
     gtgctggtaa agatcgaccg ggtaaccaag cagttcgacg agacgctggc ggtggacacc       120
     gtgtccctga ccatcaacaa gggcgagatc ttcgccctgc tcggcggctc cggctcgggt       180
     aaatccaccc tgttgcgcat gctcgccggt ttcgagcggc ccaccgaggg gcggatcttc       240
     ctcgatggcc aggacatcac cgacctgccg ccctacgagc gaccgatcaa catgatgttc       300
     cagtcctatg cgctgttccc gcacatgagc gtggcgcaga acatcgcctt cggcctcaag       360
     caggacggcc tgcccaaggc cgagatcgac gagcgcgtgg ccgagatgct caagctggtg       420
     cacatgaccc agtacgccaa gcgcaagccg caccagctct ccggcggcca gcgccagcgg       480
     gtggccctgg cccgttcgct ggccaagcgg ccgaagctgc tgctgctcga cgagccgatg       540
     ggcgcgctgg acaagaagct gcgctcgcag atgcaactgg aactggtgga gatcatcgag       600
     cgcgtcggcg tgacctgcgt gatggtgacc cacgaccagg aagaggccat gaccatggcc       660
     cagcgcatcg ccatcatgca cctgggctgc atcgagcaga tcggcagccc gatggacatc       720
     tacgagaccc cggcgagccg cctggtctgc gagttcatcg gcaacgtcaa cctgttcgac       780
     ggcgtgctgg tggaggacgt gcaggaccat gcggtgatcg cctgcccgca gctggagaac       840
     ccgatctaca tcggccacgg catcagcacc cgcgccgagg acaagcgcat cacctacgcg       900
     ctgcggccgg agaaagtgat gatcagcgcg cagaagccgg acaacctgga acacgccggg       960
     cacaactggg cccagggcac cgtctacgac atcgcctacc ttggcggcca ctcggtgtac      1020
     tacatcaagc tggcctccgg gatgatcgtc caggccttca tggccaacgc cgagcgccac      1080
     gtcgcccggc cgacctggga ccagtcggtg tacatcagct ggtacgacga cagcggcgtg      1140
     gtactgcagt catga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page