(data stored in ACNUC7421 zone)

EMBL: CP000438.SPUG

CP000438.SPUG        Location/Qualifiers
FT   CDS_pept        356417..357298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuG"
FT                   /gene_synonym="potH"
FT                   /locus_tag="PA14_03950"
FT                   /product="polyamine transport protein PotH"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03950"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15265"
FT                   /db_xref="GOA:A0A0H2ZJU9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJU9"
FT                   /protein_id="ABJ15265.1"
FT                   /translation="MPTGRHAVIGVPFLWLFLFFLLPFAIVLKISLAEADVAIPPYTEI
FT                   FAYADQQLQVLLNLGNYLMLTDDPLYIDAYLGSLKMAFISTLICLLVGYPMAYAIARSS
FT                   QSSQTVLLLLIMMPTWTAILIRVYAWMGILSNNGLLNSVLMGLGLISEPLTILNTNIAV
FT                   YIGIVYSYLPFMILPLYANLVKHDPSLLEAASDLGARNFTSFWKITVPLSKNGIIAGCM
FT                   LVFIPAVGEFVIPELLGGPETLMIGKVLWQEFFNNRDWPVASALAVVMLAILIIPIILF
FT                   NKNQAKELEGKV"
     atgcccaccg ggcggcatgc ggtcatcggg gtgccgttcc tgtggctctt cctgttcttc        60
     ctgctgccct tcgccatcgt gctgaagatc agcctggcgg aagcggacgt ggccatcccg       120
     ccctacaccg agatcttcgc ctacgcggac cagcagttgc aggtgctcct caacctcggc       180
     aactacctga tgctgaccga tgacccgctc tacatcgatg cctacctcgg ctcgctgaag       240
     atggccttca tcagtaccct gatctgcctg ctggtgggct acccgatggc ctacgccatc       300
     gcccgctcca gccagtcctc gcagactgtc ctgctgctgc tgatcatgat gccgacctgg       360
     acggcgatcc tgatccgggt ctatgcctgg atgggcatcc tttccaacaa cggcctgctc       420
     aacagcgtac tgatggggct ggggctcatc agcgagccgc tgaccatcct caataccaac       480
     atcgcggtgt acatcggcat cgtctattcc tacctgccgt tcatgatcct gccgctctac       540
     gccaacctgg tgaagcacga cccgagcctg ctggaggccg cttccgacct gggcgcgcgt       600
     aacttcacca gcttctggaa gatcaccgtg ccgctgtcga agaacggcat catcgccggc       660
     tgcatgctgg tgttcatccc ggcggtgggc gagttcgtca tcccggaact gctcggcggc       720
     cccgagaccc tgatgatcgg caaggtgctc tggcaggagt tcttcaacaa ccgcgactgg       780
     ccggtggcgt ccgccctggc ggtggtaatg ctggcgatcc tgatcatccc gatcatcctg       840
     ttcaacaaga accaggccaa agaactggag ggcaaggtat ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page