(data stored in ACNUC7421 zone)

EMBL: CP000438.SPUH

CP000438.SPUH        Location/Qualifiers
FT   CDS_pept        357381..358250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuH"
FT                   /gene_synonym="potI"
FT                   /locus_tag="PA14_03960"
FT                   /product="polyamine transport protein PotI"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03960"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15266"
FT                   /db_xref="GOA:A0A0H2ZKT6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKT6"
FT                   /protein_id="ABJ15266.1"
FT                   /translation="MKRWNFSNVMLIVGLLFIYLPMLILVIYSFNASKLVTVWGGWSVK
FT                   WYVGLLDNTQLVSSVGRSLEIAFYTAFSSVLLGTLAAFVLTRIPRFRGRTLFGGMVTAP
FT                   LVMPEVITGLSLLLLFVAMAQLIGWPQERGIVTIWIAHTSFCSSYVAVVVSARLRELDL
FT                   SIEEAAMDLGAKPWKVFLLITIPMIAPSLAAGGMMSFALSLDDLVLASFVSGPGSTTLP
FT                   MEVFSAVRLGVKPEINAVASLILLSVSLFTFFAWYFTRQAEERRRRAIQQAMEETATDW
FT                   QKGSPTPA"
     atgaagcgct ggaatttctc caacgtcatg ctgatcgtcg gcctgctctt catctacctg        60
     ccgatgctga tcctggtgat ctattcgttc aacgcctcca agctggtgac ggtgtggggc       120
     ggctggtcgg tgaagtggta cgtcggcctg ctggacaaca cccaactggt cagttcggtc       180
     ggccgctccc tggagatcgc cttctatacg gcgttctcct cggtgctcct cggcaccctg       240
     gcggccttcg tcctcacccg catcccgcgc ttccgcggtc gtacgctgtt cggcggcatg       300
     gtcaccgcgc cgctggtgat gccggaagtg atcaccggcc tgtcgctgct gctgttgttc       360
     gtggccatgg cgcaactgat cggctggccg caggaacggg gtatcgtgac catctggatc       420
     gcccacacca gcttctgctc gtcctacgtg gcggtggtgg tgtcggcgcg cctgcgtgaa       480
     ctcgacctgt cgatcgagga agcggcgatg gacctgggcg ccaagccctg gaaggtgttc       540
     ctgctgatca ccatcccgat gatcgcgccc tcgctggcgg cgggcggcat gatgtccttc       600
     gccctgtcgc tggacgacct ggtactggcc agcttcgtct ccggacccgg ctcgaccacc       660
     ttgccgatgg aagtgttctc ggcggtacgc ctgggcgtga agccggagat caacgcggtg       720
     gccagcctga tcctgctgag cgtttcgctg ttcaccttct tcgcctggta cttcacccgc       780
     caggccgagg agcggcgtcg ccgggcgatc cagcaggcga tggaagagac cgcgaccgac       840
     tggcagaaag gctcgccgac cccggcctga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page