(data stored in ACNUC7421 zone)

EMBL: CP000438.THIG

CP000438.THIG        Location/Qualifiers
FT   CDS_pept        438455..439252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="PA14_04980"
FT                   /product="thiamine biosynthesis protein, thiazole moiety"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04980"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15347"
FT                   /db_xref="GOA:Q02U32"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02U32"
FT                   /protein_id="ABJ15347.1"
FT                   /translation="MSQASSTDTPFVIAGRTYGSRLLVGTGKYKDLDETRRAIEASGAE
FT                   IVTVAVRRTNIGQNPDEPNLLDVIPPDRYTILPNTAGCYDAVEAVRTCRLARELLDGHN
FT                   LVKLEVLADQKTLFPNVVETLKAAEQLVKDGFDVMVYTSDDPIIARQLAEIGCIAVMPL
FT                   AGLIGSGLGICNPYNLRIILEEAKVPVLVDAGVGTASDAAIAMELGCEAVLMNTAIAHA
FT                   KDPVMMAEAMKHAIVAGRLAYLAGRMPRKLYASASSPLDGLID"
     atgagccaag catccagtac cgataccccc ttcgtcatcg ccggccgtac ctatggctcg        60
     cgcctgctgg tggggaccgg caagtacaag gacctcgacg agacccgccg ggccatcgag       120
     gcctccggag cggagatcgt cacggtggcg gtgcggcgca ccaacatcgg gcagaatccc       180
     gacgagccga acctactgga tgtgatcccg ccggatcgct acaccatcct gccgaacacc       240
     gccggctgct atgacgcggt cgaggccgtg cgcacctgcc gcctggcccg cgagctgctg       300
     gacgggcaca acctggtcaa gctggaagtc ctcgccgacc agaagactct gttccccaac       360
     gtcgtcgaga ccctcaaggc cgccgagcaa ctggtgaagg acggcttcga cgtgatggtg       420
     tacaccagcg acgacccgat catcgcccgc cagctggccg agatcggctg catcgcggtg       480
     atgccgctgg ccggcctgat cggctccggc ctgggcatct gcaaccccta caacctgcgc       540
     atcatcctcg aggaagccaa ggtcccggtg ctggtcgacg ccggcgtggg caccgcttcc       600
     gatgcagcga tcgccatgga gctgggttgc gaggcggtgc tgatgaacac cgccatcgcc       660
     catgccaagg acccggtgat gatggccgag gccatgaagc acgcgatcgt cgccggtcgc       720
     ctcgcctacc tggccggacg catgccgcgc aagctgtatg ccagcgcctc gtcgccgctg       780
     gacggcctga tcgactga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page