(data stored in ACNUC7421 zone)

EMBL: CP000438.TONB2

CP000438.TONB2       Location/Qualifiers
FT   CDS_pept        224119..224931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tonB2"
FT                   /locus_tag="PA14_02490"
FT                   /product="putative TonB protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02490"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15152"
FT                   /db_xref="GOA:A0A0H2ZKD4"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKD4"
FT                   /protein_id="ABJ15152.1"
FT                   /translation="MATPQPVDARTQPWRETPGGDLVALGRPVRQALHLVRHNPAQGRV
FT                   LSRRETILLVLFALTLHGAVIHWLSQQRTPALPEVPPQVPPMTIEFTAPAPPVVEPPPP
FT                   EPLPPVVEEPPPPVVDENAVKPPPPKPVPKPKPKPKPQPRPKPAPKAVEPAPPAPPQPA
FT                   APPAPPAPAAAPAPLTPPSANAGYLHNPAPEYPALAMRRGWEGTVLLRVHVLASGSPSE
FT                   IQVQKSSGREALDQAAVKAVKRWSFVPAKRGDKAEDGWVSVPIDFKLN"
     atggcaaccc cccagcccgt cgatgcccgc acgcagccct ggcgcgagac gcccggcggc        60
     gacctggtgg cgctcggtcg gccggttcgc caggcgttgc acctggttcg ccacaacccg       120
     gcacagggtc gggtgctcag ccggcgcgag acgatcctgc tggtcctgtt cgccctgacc       180
     ctgcacggag cggtgatcca ttggctgagc cagcagagaa ccccggcgct gcccgaggtg       240
     ccgccacagg tgccgccgat gaccatcgag ttcaccgccc cggcgccgcc ggtggtggaa       300
     ccgccgccgc ccgagccgtt gccgccagtg gtcgaggaac cgccaccgcc ggtggtcgac       360
     gagaacgcgg tgaagccgcc gccgccgaag ccggtgccca agccgaaacc caagcccaag       420
     ccgcaacccc ggcccaagcc ggcgccgaag gccgtcgagc cggctccgcc cgcgccgcca       480
     caacccgccg cgccacccgc cccgccggcg ccggccgctg ctccggcgcc gttgacgccg       540
     ccgtcggcga acgccggcta cctgcacaac ccggcgccgg aataccccgc cctggccatg       600
     cgccgcggct gggagggcac cgtgctgttg cgggtgcatg tcctcgccag cggcagcccg       660
     agcgagatcc aggtgcagaa gtcgagcgga cgcgaagccc tcgaccaggc cgcggtgaaa       720
     gcggtcaagc gctggtcctt cgttcccgcc aagcgcggcg acaaggccga ggacggctgg       780
     gtcagcgtac cgatcgattt caagttgaac tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page