(data stored in ACNUC7421 zone)

EMBL: CP000438.TRKA

CP000438.TRKA        Location/Qualifiers
FT   CDS_pept        complement(17389..18762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="PA14_00170"
FT                   /product="potassium uptake protein TrkA"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14972"
FT                   /db_xref="GOA:A0A0H2ZJT5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJT5"
FT                   /protein_id="ABJ14972.1"
FT                   /translation="MKIIILGAGQVGGTLAEHLASEANDITVVDTDGDRLRDLGDRLDI
FT                   RTVQGKASFPTVLRQAGADDADMLVAVTNSDETNMVACQVAYTLFNTPTKIARVREPAY
FT                   LTRTGLFDNEAIPVDVLISPEQVVTNYIKRLIEHPGALQVIDFAEGKAQLVGIKAYYGG
FT                   PLVGQELRQLREHMPNVDTRVAAIYRRNRPIIPQGDTVIEADDEVFFIAAKAHIRAVMG
FT                   EMRRLDDSYKRIIIAGGGNVGERLAEAIESRYQVKIIERSPLRCRHLSDTLDSTIVLNG
FT                   SASDRDLLLEENIGETDVFLALTNDDEANIMSSLLAKRLGASKVMTLINNPAYVDLVQG
FT                   GEIDIAISPQLATIGTLLAHVRRGDIESVHSLRRGAAEAIEVVAHGDAKSSKVIGRSIN
FT                   EIKLPPGTTIGALVRDEEVLIAHGDTHIESGDHVLLFLVDKKYIRDVERLFQAGLTFF"
     atgaaaatca tcatcctagg tgccggccag gtcggcggca cactggccga gcacctggcc        60
     agcgaagcca acgacatcac cgtggtcgac accgacggcg accgcctgcg cgacctcggc       120
     gaccgcctcg acatccgcac cgtacaaggc aaggcctcgt tccccacggt gctgcgccag       180
     gccggcgccg acgacgccga catgctggtg gcggtgacca atagcgacga gaccaacatg       240
     gtcgcctgcc aggtcgccta caccctgttc aacaccccga ccaagatcgc ccgcgtccgc       300
     gagccggcct acctgacccg taccggcctg ttcgacaacg aggcgatccc ggtggacgtg       360
     ctgatcagtc cggagcaggt ggtcaccaac tacatcaagc gcctgatcga acatcccggc       420
     gcgttgcagg tgatcgactt cgccgaaggc aaggcgcaac tggtcggcat caaggcctac       480
     tacggcggcc ctctggtagg gcaggagctg cgccagttgc gcgagcacat gccgaacgtg       540
     gatacccgcg tcgccgcgat ctaccgccgc aaccggccga tcattcccca gggcgacacg       600
     gtgatcgagg ccgacgacga agtcttcttc atcgccgcca aggcccatat ccgcgcggta       660
     atgggcgaga tgcgcaggct cgacgacagc tacaagcgga tcatcatcgc cggcggcggc       720
     aatgtcggcg agcgcctggc cgaggccatc gagagccgct accaggtgaa gatcatcgag       780
     cgcagcccgc tgcgctgccg gcacctctcg gataccctgg acagcaccat cgtgctcaac       840
     ggcagcgctt ccgaccgcga cctgctgctg gaggagaaca tcggcgagac cgacgtgttc       900
     ctcgccctga ccaacgacga cgaggccaac atcatgtcct cgctgctggc caagcggctc       960
     ggcgcgagca aggtgatgac cctgatcaac aacccggcct atgtcgacct ggtgcaaggc      1020
     ggcgagatcg acatcgccat cagcccgcaa ctggcgacca tcggcaccct gctggcccac      1080
     gttcgccgcg gcgacatcga gagcgtacac tcgctgcgcc gcggcgcagc cgaagcgatc      1140
     gaggtggtgg cccatggcga cgccaagtcg agcaaggtga tcggtcgctc gatcaacgag      1200
     atcaagctgc cgccgggcac caccatcggc gcgctggtgc gcgacgagga agtgctgatc      1260
     gcccacggcg acacccacat cgagagcggc gaccacgtgc tgctgttcct ggtcgacaag      1320
     aaatacatcc gcgacgtcga acgactgttc caggccggcc tgacgttctt ctga            1374
//

If you have problems or comments...

PBIL Back to PBIL home page