(data stored in ACNUC7421 zone)

EMBL: CP000438.YCEI

CP000438.YCEI        Location/Qualifiers
FT   CDS_pept        485413..485988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceI"
FT                   /locus_tag="PA14_05510"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05510"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15390"
FT                   /db_xref="GOA:Q02TY9"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR023480"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TY9"
FT                   /protein_id="ABJ15390.1"
FT                   /translation="MLKKTLAALALGSALFTAGQAMAADYKIDKEGQHAFIEFRIKHLG
FT                   YSWLYGRFNDFDGSFTFDEKNPSADKVKVTINTNSVDTNHAERDKHLRSGDFLNVSKNP
FT                   TATFESTEVKANGDSADITGNLTLNGVTKPVTIKAKLIGQGDDPWGGYRAGFEGSATLK
FT                   LKDFGIKMDLGPASQEVELLLSVEGIRQ"
     atgctgaaga agacccttgc cgcgctggcg ctcggctccg cactgttcac cgccggccag        60
     gcaatggccg cggactacaa gatcgacaag gaaggccagc acgccttcat cgagttccgc       120
     atcaagcacc tgggctatag ctggctgtac ggccgcttca acgacttcga cggcagcttc       180
     accttcgacg agaagaaccc gtcggccgac aaggtcaagg tgaccatcaa caccaacagc       240
     gtggacacca accatgccga gcgtgacaag cacctgcgca gcggtgattt cctcaacgtc       300
     agcaagaacc cgaccgctac cttcgaatcc accgaagtga aggccaacgg cgacagcgcc       360
     gacatcaccg gcaacctgac cctgaacggc gtgaccaagc cggtcaccat caaggccaag       420
     ctgatcggcc agggcgacga cccgtggggc ggctaccgtg ccggcttcga aggcagcgcc       480
     accctgaagc tgaaagactt cggcatcaag atggacctcg gcccggcatc ccaggaagtc       540
     gagctgctgc tctccgtcga aggcattcgc cagtaa                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page