(data stored in ACNUC7421 zone)

EMBL: CP000438.YCGB

CP000438.YCGB        Location/Qualifiers
FT   CDS_pept        complement(656629..658182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgB"
FT                   /locus_tag="PA14_07650"
FT                   /product="putative sporulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07650"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15550"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLS6"
FT                   /protein_id="ABJ15550.1"
FT                   /translation="MSKRQPIATGSEWTFELIQQYDREISRIAERYALDTYPNQIEVIT
FT                   AEQMMDAYASVGMPIGYNHWSYGKHFLSTEKNYKRGQMGLAYEIVINSDPCIAYLMEEN
FT                   TQCMQALVIAHACYGHNSFFKGNYLFRTWTDASSIIDYLVFAKQYIMQCEERYGIDAVE
FT                   DLLDSCHALMNYGVDRYKRPYPISAEEERQRQKEREELIQRQVNDLWRTIPRVGGKDKE
FT                   QSMARYPSEPQENILYFIEKNAPLLEPWQREVIRIVRKIAQYFYPQRQTQVMNEGWATF
FT                   WHYTLLNDLYDEGLVNDGFMMEFLQYHTSVVYQPSFDSPYYSGINPYALGFAMYRDIRR
FT                   ICEEPTDEDRRWFPDIAGSDWLATLKFAMKSFKDESFILQFLSPKVIRDLKLFSILDDD
FT                   QKDDLLVAAIHDEAGYRTIRETLAAQYNLGNREPNIQIWNVDRRGDRSLTLRHQQFDRQ
FT                   PLSDSTADVLKHLHRLWGFDIHLETLQGDQLVQTHHMPPKGASEGEEGYPRLDLIIPPI
FT                   "
     atgagcaagc gccagcccat cgccaccggc tcggaatgga ccttcgagct gatccagcag        60
     tacgaccggg aaatcagcag gatcgccgag cgctatgccc tggataccta tccgaaccag       120
     atcgaggtga tcaccgccga gcagatgatg gacgcctacg cctcggtggg catgccgatc       180
     ggctataacc actggtccta cggcaagcac ttcctcagta cggaaaagaa ctacaagcgt       240
     ggccagatgg gcctggccta cgagatcgtg atcaactccg acccctgcat cgcctacctg       300
     atggaggaaa acacccagtg catgcaggcg ctggtgatcg cccacgcctg ctacgggcac       360
     aacagtttct tcaagggcaa ctacctgttc cgcacctgga ccgatgccag ttcgatcatc       420
     gattacctgg tgttcgccaa gcagtacatc atgcagtgcg aggagcgcta cgggatcgac       480
     gcggtggaag acctgctcga ctcctgccac gccctgatga actacggtgt cgaccgctac       540
     aagcggccct acccgatttc cgcggaagag gagcggcagc ggcagaagga gcgcgaggaa       600
     ctgatccagc gccaggtcaa cgacctctgg cggaccatcc cgcgcgtcgg cggcaaggac       660
     aaggaacaat ccatggcgcg ctatccgagc gagccgcagg agaacatcct ctacttcatc       720
     gagaagaacg cgccgcttct ggagccctgg cagcgcgagg tgatccgcat cgtgcgcaag       780
     atcgcccagt atttctaccc gcaacgccag acccaggtga tgaacgaagg ctgggcgacc       840
     ttctggcact acacgctgct caacgacctc tacgacgaag gcctggtcaa cgacggcttc       900
     atgatggagt tcctgcaata ccacaccagc gtggtctacc agccgtcctt cgacagcccc       960
     tactacagcg gcatcaaccc ctacgccctg ggcttcgcca tgtaccgcga catccgccgc      1020
     atctgcgagg aacctaccga cgaggaccgc cgctggttcc cggatatcgc cggcagcgac      1080
     tggctggcca cgctgaagtt cgccatgaag agcttcaagg acgaaagctt catcctgcag      1140
     ttcctctcgc ccaaggtgat tcgcgacctg aagctgttca gcattctcga cgacgaccag      1200
     aaggacgacc tgctggtcgc ggcgatccac gacgaagccg gctaccgcac catccgcgag      1260
     accctggcgg cgcagtacaa cctcggcaac cgcgagccga acatccagat ctggaacgtc      1320
     gaccgtcgcg gcgaccgctc gctgaccctg cgccaccagc agttcgaccg ccagccgctg      1380
     agcgactcca ccgccgacgt gctcaagcac ctgcatcgct tgtggggctt cgatatccac      1440
     ctggagaccc tgcagggcga ccagctcgtg cagacccacc acatgccgcc caagggcgcc      1500
     agcgagggcg aggaaggcta cccgcgcctg gacctgatca tcccgcccat ttga            1554
//

If you have problems or comments...

PBIL Back to PBIL home page