(data stored in ACNUC7421 zone)

EMBL: CP000438.YCGM

CP000438.YCGM        Location/Qualifiers
FT   CDS_pept        372315..372980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgM"
FT                   /locus_tag="PA14_04150"
FT                   /product="putative fumarylacetoacetate hydrolase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04150"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15281"
FT                   /db_xref="GOA:A0A0H2ZKV0"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKV0"
FT                   /protein_id="ABJ15281.1"
FT                   /translation="MSYQHQYIDGTPIHFPLGKLVCVGRNYAEHAKELNNPVPTEPLLF
FT                   IKPGSCVVPVSGGLSLPQERGSVHYEAEIAVLIGKPLSRKPNREEVLDAISGYAPALDL
FT                   TLREVQAKLKEKGLPWELAKSFDGAGVLSPFVNADQFPDPTDIGIRLTINGEVRQDGNS
FT                   RDMLNPIVPLIQHIAGHFSLQAGDVVLTGTPSGVGPLNSGDELLLELPGASRFETRVL"
     atgagttacc agcatcaata tatcgacggc accccgatcc acttccccct gggcaagctg        60
     gtctgcgtcg ggcgcaacta cgccgaacac gccaaggaac tgaacaaccc ggttcccacc       120
     gagccgctgc tgttcatcaa gcccggctcc tgcgtggtgc cggtgagcgg cgggctgagc       180
     ctgccgcagg agcgcggctc ggtacactac gaggcggaaa tcgccgtgct gatcggcaag       240
     ccgctgtcgc gcaagccgaa ccgcgaggag gtcctcgacg cgatctccgg ctatgcgccg       300
     gcgctggacc tgaccttgcg cgaggtccag gcgaaactga aggaaaaggg cctgccctgg       360
     gagctggcaa agagcttcga tggcgccggc gtgctgtcgc cgttcgtgaa cgccgaccag       420
     ttccccgacc cgaccgacat cggcatccgc ctgaccatca acggcgaggt gcgccaggac       480
     ggcaacagcc gcgacatgct caatccgatc gtgccgctga tccagcacat cgccgggcat       540
     ttctcgctac aggccggcga tgtggtgctg accggcacgc cgtccggggt cgggccgctg       600
     aacagcggcg acgagttgct gctcgaattg ccgggcgcca gccgtttcga gacccgcgtg       660
     ctctga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page