(data stored in ACNUC7421 zone)

EMBL: CP000438.YHIN

CP000438.YHIN        Location/Qualifiers
FT   CDS_pept        complement(626346..627524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhiN"
FT                   /locus_tag="PA14_07280"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07280"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15522"
FT                   /db_xref="GOA:A0A0H2ZKU8"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKU8"
FT                   /protein_id="ABJ15522.1"
FT                   /translation="MASTDVLIVGAGAAGLMCAMTAAGRGRRVRVLDHANKAGKKILMS
FT                   GGGRCNFTNLYTEPANFLSRNPHFCKSALARYTQWDFIGLVAKHQVPYHEKKLGQLFCD
FT                   NKSSDILEMLLRECAEAGAEILLDTSIEEIARDDAGYRLRTSAGEMRCESLVIASGGLS
FT                   IPTLGASGFGYQVARQFGHEVLPTRAGLVPFTITDQLKELCAELSGTSVDCRVSCNGQA
FT                   FRENLLFTHRGLSGPAMLQISSYWQPGDTLEIDLLPDHDASEWLAQQQRERPNSELKTL
FT                   LAELFTKKLAGLLADRWFVSKPMKQYTPTELAGIAGQLSAWRVTPSGTEGYRTAEVTLG
FT                   GVSTDEVSSKTMESQRSPGLYFVGEVLDVSGHLGGFNFQWAWASGYAAGQYA"
     gtggcaagta cagatgtgct gatcgttggc gccggggcgg ccgggctgat gtgtgcgatg        60
     acggcggccg ggcgcgggcg ccgcgtgcgg gtactcgacc acgccaacaa ggccggcaag       120
     aagatcctca tgtccggcgg cgggcgctgc aatttcacca acctgtacac cgagccggcc       180
     aacttccttt cgcgcaaccc gcacttctgc aagtcggcgc tggcccgcta cacccagtgg       240
     gacttcatcg gcctggtggc caagcaccag gtgccgtacc acgagaagaa actcggccag       300
     ctgttctgcg acaacaagtc cagcgacatc ctcgagatgc tgctgcgcga atgcgccgag       360
     gccggagcgg aaatcctgct ggacacctcg atcgaagaga tcgcccgcga cgacgccggc       420
     taccgcctgc gtaccagcgc cggcgagatg cgctgcgagt cgctggtgat cgccagcggc       480
     ggcctgtcga tcccgaccct cggcgccagc ggtttcggct accaggtggc gcgccagttc       540
     ggccatgagg tgctgccgac ccgcgccggg ctggtgccgt tcaccatcac cgaccaattg       600
     aaggagctgt gcgccgagct ttccggcacc tcggtggatt gccgggtgag ctgcaacggc       660
     caggcgttcc gcgagaacct gctgttcacc caccgcggcc tcagcggccc ggcgatgttg       720
     cagatttcct cctactggca accgggcgat accctggaaa tcgacctgct gccggaccac       780
     gacgccagcg aatggctggc gcagcaacag cgcgagcgtc ccaacagcga gctgaagacc       840
     ctgctcgccg agttgttcac caagaagctc gccggactgc tggccgaccg ctggttcgtc       900
     tccaagccga tgaaacagta caccccgacc gaactggcgg gtatcgccgg gcagctttcg       960
     gcctggcggg tcacgccctc gggcaccgag ggctaccgca ccgcggaagt gaccctgggc      1020
     ggggtgagca ccgacgaagt gtcgtcgaag accatggagt cgcagcgctc gccggggctg      1080
     tatttcgtcg gcgaagtact ggacgtcagc ggccacctcg gcggcttcaa cttccagtgg      1140
     gcctgggcct cgggttatgc ggcgggacag tacgcctag                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page