(data stored in ACNUC7421 zone)

EMBL: CP000438.YICE

CP000438.YICE        Location/Qualifiers
FT   CDS_pept        complement(408603..409988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yicE"
FT                   /locus_tag="PA14_04610"
FT                   /product="putative xanthine/uracil permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04610"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15316"
FT                   /db_xref="GOA:A0A0H2ZKR9"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKR9"
FT                   /protein_id="ABJ15316.1"
FT                   /translation="MSSLQSPSDASARNDLVYGLDDRPSAPIALLAALQHLLAIIVPIV
FT                   TPGLLICQALGVSPRDTNLIVSMSLVISGIATFVQCKRFGPFGAGLLIVQGTSFNFVGP
FT                   LIAGGALMVKQGTPVESVMAAIFGVVIAGSFVEMGISRILPFVKRLITPLVTGIVVLMI
FT                   GLTLIKVGLISMGGGFSAMSNGTFANGENLLLSGVVLGIIVVLNRIPVVWMRSCAIVIA
FT                   LAVGYALAGYLGRLDFTGMHQAELFQVPTPLHFGLDFSWPLFIPMLVIYLVTSLEAIGD
FT                   VTATSKVSKQPVEGPLWMQRIKGGVLVNGANSFLAGIFNTFPSSVFAQNNGVIQLTGVA
FT                   SRYVGLWIAAMLVLLGLFPSVAGVIQAVPEPVLGGAAMVMFGAVAASGINILAGIQLDR
FT                   RALLIIAVSLALGLGVSQVPEFLAHMPAALRNVLESGVATGGICALLLNWFLPESPVQK
FT                   AGH"
     atgagttccc tgcaaagccc gtcggacgcc agcgcccgca acgacctggt ctatggcctg        60
     gacgaccgtc ccagcgctcc catcgccctg ctcgccgccc tccagcacct gctggcgatc       120
     atcgtgccga tcgttacccc cggcctgctg atctgccagg cgctgggcgt atcgccgcgc       180
     gacaccaatc tgatcgtgtc gatgtcgctg gtgatctccg gcatcgccac cttcgtccag       240
     tgcaagcgct tcggcccgtt cggcgccgga ctgttgatcg tccagggcac cagcttcaac       300
     ttcgtcggcc cgctgatcgc cggcggggcg ctgatggtca agcagggcac gccggtggaa       360
     agcgtgatgg cggcgatctt cggcgtggtc atcgccggct ccttcgtcga gatgggcatc       420
     tcgcgcatac tgccgttcgt caagcggctg atcaccccgc tggtgaccgg catcgtcgtg       480
     ctgatgatcg gcctgaccct gatcaaggtc ggcctgatca gcatgggcgg cggcttctcg       540
     gcgatgtcca acggcacctt cgccaacggc gagaacctgc tgctgtccgg cgtggtgctg       600
     ggcatcatcg tggtgctcaa tcgcatcccg gtggtatgga tgcgcagttg cgccatcgtc       660
     atcgccctgg ccgtcggcta cgcgctggcc ggctacctcg gccgcctgga cttcaccggc       720
     atgcaccagg ccgagctgtt ccaggtaccg accccgctgc acttcggcct ggacttctcc       780
     tggccgctgt tcatcccgat gctggtgatc tacctggtca cctccctgga agccatcggc       840
     gacgtcaccg ccaccagcaa ggtgtcgaag caaccggtgg aaggcccgct gtggatgcag       900
     cggatcaagg gcggcgtgct ggtcaacggc gccaactcgt tcctcgccgg tatcttcaat       960
     accttcccca gctcggtgtt cgcccagaac aacggggtga tccagctcac cggcgtggcc      1020
     agccgctacg tcggcctgtg gatcgccgcc atgctggtcc tgctcggcct gttcccgagc      1080
     gtcgccgggg tcatccaggc ggtgccggaa ccggtactgg gcggcgcggc gatggtgatg      1140
     ttcggcgcgg tggccgcttc gggcatcaac atcctcgccg gcatccagct ggaccgccgc      1200
     gccctgctga tcatcgccgt gtccctggcc ctcggcctgg gcgtttcgca ggtgccggag      1260
     ttcctcgcgc acatgcccgc ggcgctgcgc aacgtgctgg aatccggggt cgccaccggc      1320
     ggcatctgcg ccctgctact gaactggttc ctgccggaaa gcccggtcca gaaggccgga      1380
     cactga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page