(data stored in ACNUC7421 zone)

EMBL: CP000438.YQJC

CP000438.YQJC        Location/Qualifiers
FT   CDS_pept        complement(609732..610151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqjC"
FT                   /locus_tag="PA14_07040"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07040"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15505"
FT                   /db_xref="InterPro:IPR009468"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKT4"
FT                   /protein_id="ABJ15505.1"
FT                   /translation="MSIRPSLPLAGLLLAVSLPLSAAQPGTTKGAPLSGCAAKQAAIEA
FT                   KLETARSFANEGQVAGLEKALSEVKEHCTEAGLLRENKQKVIDSEREVSEREKDLRKAM
FT                   GKGDPEKIEKRKAKLAEARAELEEAKKGLEQAQAQ"
     atgtccattc gtccttcact gccgctggcc gggctgctgc tcgccgtctc cctgccgctc        60
     tccgccgccc agccgggcac caccaaaggc gccccgctca gcggttgcgc cgccaagcag       120
     gccgccatcg aggcgaagct ggaaacggcc cgctcgttcg ccaacgaagg ccaggtggcc       180
     ggcttggaaa aggccctctc cgaggtcaag gaacactgca ccgaagccgg cctgctgagg       240
     gagaacaagc agaaggtgat cgacagcgag cgcgaggtca gcgaacgcga gaaggatttg       300
     cgcaaggcca tgggcaaggg cgatccggag aagatcgaga aacgcaaggc caagctggcc       360
     gaggcccgcg ccgaactgga agaggccaag aaaggcctgg aacaggccca ggcacagtag       420
//

If you have problems or comments...

PBIL Back to PBIL home page