(data stored in ACNUC7421 zone)

EMBL: CP000462.AHYR

CP000462.AHYR        Location/Qualifiers
FT   CDS_pept        591318..592103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahyR"
FT                   /locus_tag="AHA_0557"
FT                   /product="transcriptional activator protein AhyR"
FT                   /note="identified by similarity to SP:P0A3J6; match to
FT                   protein family HMM PF00196; match to protein family HMM
FT                   PF03472; match to protein family HMM PF04967"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37236"
FT                   /db_xref="GOA:A0KFR4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFR4"
FT                   /protein_id="ABK37236.1"
FT                   /translation="MKQDQLLEYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIP
FT                   MSMQRPKVVLFNQCPDSWVQAYTANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEG
FT                   SLDVMGLAAEFGLRNGISFPLHGAAGENGIILSFITAERASSDLLLESSPILSWMSNYI
FT                   FEAAIRIVRVSLREDDPQEALTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQV
FT                   TRKTGSMNRYQAIAKGVSSGILLPNLEQVVVTNFPKLMQ"
     atgaaacaag accaactgct tgagtacctc gaacatttca cttcggtaac ggacggggat        60
     cgtttggccg agttgatcgg tcggttcacg ctcggtatgg gttacgacta ctaccggttt       120
     gcgctgatca ttcccatgtc gatgcaaaga cccaaggtgg tgctgttcaa ccagtgccca       180
     gactcctggg tgcaggccta cacggccaac catatgctgg cctgtgatcc catcattcaa       240
     ttagcccgca agcagacctt gcccatttac tggaaccggc tggatgagcg ggcgcgtttt       300
     ctgcaagagg gcagtcttga cgtgatgggg ttggcggcgg agttcgggct gcgcaacgga       360
     atttcgttcc cgttgcacgg tgcggcaggg gagaacggca tcatactgtc gttcatcacc       420
     gccgagcggg catcgagcga tctgctgctg gagtcctcgc ccatcctctc ctggatgtcc       480
     aactacatct tcgaggcggc gatccggatt gtgcgggtca gtctgcggga agatgaccct       540
     caggaggccc tgactgaccg ggagaccgaa tgcctgttct gggccagtga agggaaaacg       600
     tcgggtgaaa tcgcctgcat cctggggatc acggagcgaa ccgtgaacta ccacctcaat       660
     caggtcaccc gtaaaacggg gtcgatgaat cgctaccagg ccatcgccaa gggggtgagc       720
     agtggcattt tgctgcccaa tctcgagcag gtcgtggtca ccaacttccc caagctgatg       780
     caataa                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page