(data stored in ACNUC7421 zone)

EMBL: CP000462.CODA

CP000462.CODA        Location/Qualifiers
FT   CDS_pept        90960..92225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codA"
FT                   /locus_tag="AHA_0082"
FT                   /product="cytosine deaminase"
FT                   /EC_number="3.5.4.1"
FT                   /note="identified by similarity to SP:P25524; match to
FT                   protein family HMM PF01979; match to protein family HMM
FT                   PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38390"
FT                   /db_xref="GOA:A0KEF4"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEF4"
FT                   /protein_id="ABK38390.1"
FT                   /translation="MLIKNLRLVGREGMWQILCQDGLIRAIEPMSTHLLAAHELDGEEG
FT                   LAIAPFIEPHIHLDTTQTAGEPSWNLSGTLFEGIERWAERKALLTHEDVKQRVIQTLKW
FT                   QIANGIQFVRTHVDVSDPNLVALKAMLEVREEMKEWVELQIVAFPQEGILSYPNGKALL
FT                   EEALKLGADVIGAIPHFEFTREYGVESLHYVFDLAEKYQVLVDVHCDEIDDEQSRFIET
FT                   LATLAYERGMGHRVTASHTTAMHSYNGAYASRLFRLLKMADINFVANPLVNIHLQGRFD
FT                   SYPKRRGITRVKEMLEANINVCFGHDDVFDPWYPMGTANLLQVLHMGLHVCQIMGYEQI
FT                   NDSLKLISSHSARTLNVQDRYGIEVGKPANLLILPAENGFDAVRRQVAVRYSIRHGRVI
FT                   AQTTPSRTSIHLAQVEPVDFRR"
     atgctgataa agaacctgcg tctggtcggc agggagggga tgtggcagat cctctgccag        60
     gatggcctga tccgagccat cgaacccatg agcacccatc tgctcgcagc ccacgagctt       120
     gatggtgagg aggggctcgc catcgccccc tttatcgagc ctcacatcca tctcgatacc       180
     acccagacag ccggtgagcc gagttggaac ctctccggca ccctgttcga ggggatcgaa       240
     cgctgggccg agcgcaaggc actgctgacc catgaggatg tgaaacagcg tgtcatccag       300
     acgctaaagt ggcagatcgc caacggcatc cagttcgtcc gcacccacgt ggatgtctcc       360
     gaccccaatc tggtcgccct gaaggcgatg ctggaggtgc gggaggagat gaaggagtgg       420
     gtggagctgc agatagtggc cttcccgcag gaggggatcc tctcctaccc caacggcaag       480
     gcgctgttgg aggaggcgct caagctgggg gctgatgtga ttggtgcgat tccccacttc       540
     gagtttaccc gggaatatgg ggtcgaaagt ctgcactacg tgttcgatct tgccgagaag       600
     tatcaggttc tggtggatgt gcactgcgac gagatcgatg acgagcagtc ccgcttcatc       660
     gagacgctgg cgaccctggc ctacgagcgt ggcatgggcc atagagtcac cgccagccac       720
     accaccgcga tgcactccta caacggtgcc tatgcgtccc gcctgttccg gctgctgaag       780
     atggcggaca tcaacttcgt cgctaacccg ctggtgaaca tccacctgca ggggcgcttc       840
     gacagctatc ccaagcgtcg cggcatcacc cgggtgaagg agatgctgga agcgaacatc       900
     aatgtctgtt tcggtcatga cgacgtgttc gatccctggt atcccatggg caccgccaac       960
     ctgctgcagg tgctgcatat ggggctgcat gtctgccaga tcatgggcta cgagcagatc      1020
     aacgacagtc tcaagctgat cagcagccac agtgcacgca ccctgaacgt gcaggatcgc      1080
     tacggcatcg aggtgggcaa accagccaac ctgctgatcc tgcccgccga gaacggcttt      1140
     gatgcggtgc gccgccaggt ggcggtgcgt tactccattc gccacggccg ggtgattgca      1200
     caaaccactc catcccgcac ctcgattcat cttgctcagg tcgagccggt cgactttcgc      1260
     cgctga                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page