(data stored in ACNUC7421 zone)

EMBL: CP000462.CPXA

CP000462.CPXA        Location/Qualifiers
FT   CDS_pept        complement(204372..205727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxA"
FT                   /locus_tag="AHA_0189"
FT                   /product="sensor histidine kinase CpxA"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by similarity to SP:P08336; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF00672; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37467"
FT                   /db_xref="GOA:A0KEQ7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEQ7"
FT                   /protein_id="ABK37467.1"
FT                   /translation="MRTARTFNGLSTQIFLWFWFMLLLVVAAVVILPTLDPRNIIPLPA
FT                   HEITRLNNNLKALQKGADPNQDFDLAQAIDAAGLLPVDNIYLRDAKGQMQSSTRLSKFV
FT                   IRFMLDSDNPAKPMLGSEHKRAIAGPFQMTHHGQIYHIYFGLNVENSYLFLFIQILDHP
FT                   IQILGIAMLVSTPLCLLLAWRLTRPILQLQQSVSQLAEGNLEAQIPNLGRRDEIGQLAD
FT                   HVSHMVDTLKNMIQKQKQLLSDISHELRSPLTRIQLAQALIRRKQGDSNELVRIESEIG
FT                   RLDKLIGDLLDLSRVQQHVEAPVVMPLAELLEPILDDAMFEANQSGKQLRLPPLPAESL
FT                   RMWPDLLARALENPLRNALKYAREFIKVDWYREGLEWVMTIRDDGPGVPVAQQAQLFLP
FT                   FFRVDDARNAKTGGTGLGLAIAAEAIARHGGTIRASSNQPAGLTITIRLPIG"
     atgagaaccg cccgcacctt caacggtctc tccacccaga tcttcctctg gttctggttc        60
     atgctgttgc tggtggtggc cgccgtggtg atcctcccga ccctggatcc ccgcaacatc       120
     attccgctgc cggcccacga gatcacccgc ctcaacaaca acctgaaggc gctgcagaag       180
     ggggctgacc ccaatcagga tttcgatctg gcccaggcca tcgatgccgc cggtctgctg       240
     ccggtcgaca acatctattt gcgcgatgcc aagggacaga tgcagtccag cacccgcctg       300
     agcaagttcg tgatccgttt catgctcgac tcggacaacc cggccaagcc catgctgggc       360
     agcgagcaca agcgggccat cgccggcccc ttccagatga cgcatcacgg ccagatctac       420
     cacatctact tcggcctcaa cgtcgagaac tcctatctgt ttctgttcat ccagatcctg       480
     gatcacccga tccagatcct cggcatcgcc atgctggtca gcaccccgct ctgtctgctg       540
     ctggcctggc ggctgacccg ccccatcctg cagctgcagc agtcggtctc ccagctggcg       600
     gagggcaatc tggaggcgca gatccccaat ctgggacggc gggacgagat cggccagctg       660
     gcggatcacg tcagccacat ggtcgatacc ctcaagaaca tgatccagaa gcagaagcag       720
     ctgctctccg acatctccca cgagctgcgc agcccgctca cccgcattca gctggcgcag       780
     gcgctgatcc gtcgcaaaca gggggacagc aacgagctgg tgcggatcga atcggagatc       840
     ggccggctcg acaagctgat cggcgacctg ctcgacctgt cgcgggtaca gcagcatgtg       900
     gaagcgccgg tggtgatgcc gctggccgag ctgctggagc ccatcctgga cgacgccatg       960
     ttcgaggcaa accagagcgg caagcagctc aggttgccgc cgctgccggc tgaatcgctg      1020
     cggatgtggc ccgatctgct ggcgcgggca ctggagaatc cactgcgcaa cgcgctcaaa      1080
     tacgcccgcg agttcatcaa ggtggactgg tatcgggagg gactggagtg ggtgatgacc      1140
     atccgcgacg acggtcccgg cgtgccggtg gcgcagcagg cccagctgtt cctgcccttc      1200
     tttcgggtgg acgatgcccg caacgccaag accggcggca ccgggctggg gctggccatc      1260
     gccgccgagg ccattgcgcg ccacggcggc accatccgcg ccagcagcaa tcaaccggcc      1320
     gggctgacca tcaccatccg cctgcccatc ggctga                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page