(data stored in ACNUC7421 zone)

EMBL: CP000462.CYAA

CP000462.CYAA        Location/Qualifiers
FT   CDS_pept        500161..502695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaA"
FT                   /locus_tag="AHA_0470"
FT                   /product="adenylate cyclase, class I"
FT                   /EC_number="4.6.1.1"
FT                   /note="identified by similarity to SP:P00936; match to
FT                   protein family HMM PF01295"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36798"
FT                   /db_xref="GOA:A0KFH7"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="InterPro:IPR024686"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFH7"
FT                   /protein_id="ABK36798.1"
FT                   /translation="MLVKLDTLVARYDELNRLKTQRALGLMSRYGQQVFQLLPVMLHFN
FT                   HPLLPGYVAGDVPHGIWSFTANDAQQAFIEDLCQNANCLNGLTTHDKSIQGLYSMGSTS
FT                   SIGQCCHSDLDIWVCHVAGLSQERLELLDLKCQQLSKWAEQRGVDLNFFLIPEDKFRQR
FT                   NDAQMQGESCGSAQHLLLLDEFYRSAMLIAGKRLLWYLVPSEYDDHYDDYVNGLFAHGK
FT                   LSQDDWLDLGGFNRIPAEEYFGSALWQLYKGIDSPYKAVLKSVLMEAYSHEYPNTRLLS
FT                   VTSRDWFQHNEGMHYRLDNYCLMLDKVTNYLKSIGDMQRLDLVRRCFYLKVCDGLSHPK
FT                   EEHSPAWRREQMTQLVSYWGWSQERLHHLDHRQEWKVEDVKVAHAELLEALMQSYRNLI
FT                   QFARRNNISESINPEDIGILSRKLYAAFESLPGKVQRINLKIAPDLSEPDLSFVQVPHG
FT                   RLNRAGWYLYKHSLEPADIIGRAPLEYNGYISKLVSWAYFNGLLTPQSRVHLFNQGSDL
FT                   HIDNLHQFCRDLSGTFPVKYPRATNLALSRPCEIRQLSIFLNLETDPTSHWVGQVIEFD
FT                   ANAADVFSFGRNQECLVGSVDLVYRNSWSEIRTLHFQGDEAVVDALTTILGKMHQDAAA
FT                   PEMIEVFCYSQHFRSLVRTRFQQLVAECIELRLARDKQQLVKTLALGKEKYGIFFERRG
FT                   VSVKKLENAVDFYRHISHNKLDHLPLRLDKTHSQHLPGIVDAYASEGLVQFFFDTRDAG
FT                   TNIYILDEANRVEIYQHFAGNKDELVQGVNRFYTSSHERFSDAGQFSNFNLPQYYEIVQ
FT                   INGELEVIPYRSQGQLRDGGQGRELGSAAGAG"
     ttgctggtaa aactcgacac gctggtggcg cgctacgacg aactcaatcg tctcaagacg        60
     caacgggcgc taggtctcat gagtcgctac gggcagcagg tttttcagct gctacccgtc       120
     atgctgcact tcaatcaccc tctgctgcct ggttacgtgg cgggggatgt gccgcacggc       180
     atctggagtt ttaccgccaa tgacgcacag caggccttca tcgaggatct gtgccagaac       240
     gccaactgcc tgaacggcct caccacccat gacaagtcga tccaggggct ctactccatg       300
     ggcagcacct cgtccatcgg ccagtgctgc cactcggatc tcgacatctg ggtctgccac       360
     gtggccggtt tgtcgcagga gcggctcgag ctgctggatc tcaagtgcca gcaactctcc       420
     aagtgggccg agcagcgcgg ggtcgatctc aacttcttcc tgatccccga ggacaagttc       480
     cgccagcgca acgatgccca gatgcagggt gagagctgcg gcagcgccca gcacttgctg       540
     ctgctcgacg agttctaccg cagcgccatg ctgatcgccg gcaagcggtt gctctggtat       600
     ctggtgccca gcgagtatga cgaccactac gacgactacg tcaacggcct gttcgcccac       660
     ggcaagctga gccaggatga ctggctcgat ctcggtggct tcaaccgcat tccggccgag       720
     gagtacttcg gctctgccct ctggcagctc tacaagggca tcgactcccc ctacaaggcg       780
     gtgctcaagt cggtgttgat ggaggcctac tcccacgagt atcccaacac ccgtctgctg       840
     tcggtgacca gccgcgactg gttccagcac aacgagggga tgcactaccg gctcgacaac       900
     tactgcctga tgctggacaa ggtgaccaac tacctcaagt ccatcggcga catgcagcgg       960
     ctcgatctgg tgcgccgctg tttctatctg aaggtgtgtg acggtctcag ccacccgaag      1020
     gaggagcact ccccggcctg gcgccgcgag cagatgaccc agctggtctc ctactggggc      1080
     tggagtcagg agcggttgca ccatctggat caccgccagg agtggaaggt cgaggacgtc      1140
     aaggtggctc acgccgaact gctggaagcc ctgatgcaga gctaccgcaa cctgatccag      1200
     ttcgcccggc gcaacaacat cagcgagtcc atcaacccgg aagacatcgg catcctgtcg      1260
     cgcaagctct atgccgcgtt cgagagcctg ccgggcaagg tacagcgcat caacctcaag      1320
     attgcgccgg acttgagcga accggatctc agcttcgtgc aggtgccgca cggccgcttg      1380
     aaccgcgccg gctggtatct ctacaaacat tcgctggagc cggctgacat catcggtcgg      1440
     gcgccgctcg aatataacgg ctatatcagc aagctggtgt cgtgggccta cttcaacggc      1500
     ctgctgacgc cccagtcgcg ggtgcacctg ttcaatcagg gctcggatct gcacatcgac      1560
     aacctgcacc agttctgtcg cgatctgtcc ggcaccttcc cggtcaagta tccccgcgcc      1620
     accaacctgg ccctcagccg gccgtgcgaa attcgccagc tctccatctt cctcaacctg      1680
     gagacggacc cgaccagtca ctgggtgggc caggtgatcg aattcgacgc caacgccgcc      1740
     gacgtcttct cgttcggccg caaccaggag tgtctggtgg gctcggtgga cctggtctat      1800
     cgcaactcct ggagcgagat ccgtaccctg cacttccagg gggacgaggc ggtggtggat      1860
     gctctcacca ccatcctcgg caagatgcat caggatgccg ccgcccccga gatgatcgag      1920
     gtgttctgct acagccagca cttccgctcc ctggtgcgta cccgcttcca gcagctggtg      1980
     gccgagtgca tcgagctgcg tctggctcgc gacaagcagc agctggtcaa gacgctggcg      2040
     ctcggcaagg agaagtacgg catcttcttc gagcggcgcg gggtgtcggt caagaagctg      2100
     gagaacgcgg tcgacttcta tcgccacatc tcccacaaca agctggatca cctgccgctg      2160
     cggctcgaca agacccatag ccagcatctg cccggcatcg tcgacgccta cgccagcgag      2220
     gggctggtgc agttcttctt cgatacccgg gatgcgggca ccaacatcta tatcctggac      2280
     gaggcgaacc gggtggagat ctaccagcac ttcgccggca acaaggatga gctggtgcag      2340
     ggggtgaacc gcttctatac ctccagccac gagcgcttca gcgacgcggg ccagttcagc      2400
     aacttcaact tgccccagta ctacgagata gtgcagatca atggcgagct ggaagtgatc      2460
     ccctaccgca gccagggtca gctgcgcgac ggtggtcagg ggcgcgagct cggctccgcc      2520
     gcaggcgcgg ggtag                                                       2535
//

If you have problems or comments...

PBIL Back to PBIL home page