(data stored in ACNUC7421 zone)

EMBL: CP000462.CYSE

CP000462.CYSE        Location/Qualifiers
FT   CDS_pept        207426..208205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="AHA_0192"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="identified by match to protein family HMM PF06426;
FT                   match to protein family HMM TIGR01172"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39160"
FT                   /db_xref="GOA:A0KER0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A0KER0"
FT                   /protein_id="ABK39160.1"
FT                   /translation="MDDLVARTWQKIQQEAASMATEEPMLASFFHSTILNHKNLRSALS
FT                   FQLANKLDSATMPAIALREVIELALRSEPELLAVVAADICAVQERDPAVDLFSTPLLYL
FT                   KGFHALQGYRVANWLWRQGRRSLALYLQNQISVVFGVDVHPAARIGKGIMFDHATGIVV
FT                   GETAVIEDDVSILQSVTLGGTGKESGDRHPKIREGVMIGAGAKVLGNIEVGMGAKIGAG
FT                   SVVINPVPPHTTVAGVPAKIVGRPECDKPSLDMDQCL"
     atggatgatc tggttgccag aacctggcaa aaaattcagc aagaagcggc gagcatggcg        60
     accgaagagc ccatgctggc cagcttcttc cactccacca ttctcaatca caaaaacctg       120
     cgttcggccc tcagcttcca gctggccaac aagctcgaca gcgccaccat gcccgccatc       180
     gccctgcgcg aggtgatcga gctggccctg cgcagcgagc ccgagctgct ggcggtcgtg       240
     gcggccgaca tctgtgcggt gcaggagcgc gacccggcgg tcgatctctt ctccaccccg       300
     ctgctctacc tcaagggatt ccatgccctg caaggctacc gggtcgccaa ctggctgtgg       360
     cgccaggggc gtcgttcgct ggcgctctac ctgcagaacc agatctcggt ggtattcggg       420
     gtggacgtgc acccggccgc ccgcatcggc aagggcatca tgtttgacca tgccaccggc       480
     atcgtggtcg gcgagacggc ggtgatcgag gacgatgtct ccatcctgca gagcgttacc       540
     ctgggtggta ccggcaagga gagcggcgat cgccacccca agatccggga aggggtgatg       600
     ataggggcgg gcgccaaggt gctcggcaac atcgaggtgg gcatgggggc caagatcggc       660
     gccggcagcg tggtgatcaa cccggtgccg ccacacacca cggtggcggg cgtacccgcc       720
     aagatcgtgg gtcgtccgga gtgcgacaag ccttcgctgg acatggatca gtgtctctga       780
//

If you have problems or comments...

PBIL Back to PBIL home page