(data stored in ACNUC7421 zone)

EMBL: CP000462.CYSQ-1

CP000462.CYSQ-1      Location/Qualifiers
FT   CDS_pept        618378..619190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ-1"
FT                   /locus_tag="AHA_0584"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /EC_number="3.1.3.7"
FT                   /note="identified by match to protein family HMM PF00459;
FT                   match to protein family HMM TIGR01331"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35844"
FT                   /db_xref="GOA:A0KFU1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFU1"
FT                   /protein_id="ABK35844.1"
FT                   /translation="MQELLAWVPGVKEIAREAGRILHEIYHGGQFERQLKEDATPVTSA
FT                   DLAADAYLKQALSALTPHVPVLTEEAADIPFSQRANWRQYWLVDPLDGTGEFIAGSGDF
FT                   ATLIALVQDNVPVLGVIYAPESNVLYWAVRGHGAFKEANGEVHPISAMHHEHDQPDSLV
FT                   VAISRRQKLENLTRRLNPAINYELIPLGSSSLKSCLVAEGAADCYVRLGPTGEWDTAAA
FT                   QCIVEAAGGRILSLALQPLRYNETESLENPDFIVMGDPDLAWGSILAH"
     atgcaggagt tgttggcctg ggtgccgggg gtcaaggaga tcgcgcgcga agcgggccgg        60
     atccttcacg aaatctatca cggcggtcag ttcgagcgtc agctgaagga ggatgcgacc       120
     ccggtcacca gtgccgatct tgctgccgat gcctacctca aacaggcgct gtcggcgctc       180
     actccccacg ttcccgtgct gaccgaagag gcggccgaca tccctttcag ccagcgcgcc       240
     aactggcgcc agtactggct ggtggatccc ctcgacggca ccggcgagtt catcgccggc       300
     agcggcgact tcgccacctt gatcgccctg gtgcaggaca atgtgccggt gcttggcgtc       360
     atctatgccc ccgagtcgaa cgtgctctac tgggcggtgc gcggtcatgg cgcctttaag       420
     gaggcgaacg gcgaggtgca ccccatcagc gccatgcacc acgagcacga tcagcccgat       480
     tcgctggtgg tggccatcag ccgtcgtcag aagctggaga acctgacccg ccgcctcaac       540
     ccggccatca actacgagct gatcccgctc ggctccagct cgctcaagtc ctgcctggtg       600
     gcggaagggg cggccgactg ctacgtgcgg ctcggcccca ccggcgagtg ggacaccgcc       660
     gccgcccagt gcatcgtcga ggcggccggt ggccgcatcc tcagcctggc gctgcagccg       720
     ctgcgctaca acgagacaga gtcgctggag aacccggact tcatcgtgat gggggatccg       780
     gatctcgcct ggggcagcat tctggcgcac tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page