(data stored in ACNUC7421 zone)

EMBL: CP000462.DAPF

CP000462.DAPF        Location/Qualifiers
FT   CDS_pept        505388..506218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="AHA_0474"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="identified by match to protein family HMM PF01678;
FT                   match to protein family HMM TIGR00652"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38916"
FT                   /db_xref="GOA:A0KFI1"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFI1"
FT                   /protein_id="ABK38916.1"
FT                   /translation="MLIDFSKMHGLGNDFMVVDGVTQKVFFSNEVIKKLADRHFGIGFD
FT                   QLLLVEPPYDPELDFHYRIFNADGSEVEQCGNGARCFARFVRLKGLINRDRIAVSTARG
FT                   RIVLQLEGENQVTVNMGVPQFEPGKIPFRAQKAEKTYLLRAQEHTVMCGAVSMGNPHCV
FT                   IEVPSVADAPVATLGPIMERHERFPERVNVGFMEMVNASEIKLRVFERGVGETLACGTG
FT                   ACAAVVVGISQGKLKERVTVTLPGGKLTIAWKGPGQPVYMTGPAEHVFDGQIEL"
     atgttgatag atttttccaa gatgcacggg ctggggaacg acttcatggt ggtggatggc        60
     gtcacccaga aggtgttttt cagcaatgag gtcatcaaga agctggcgga tcgccatttc       120
     ggcatcggct tcgaccagct gctgctggtg gagccgccct atgatcccga gctcgacttt       180
     cactaccgca tcttcaatgc cgatggcagc gaggtggagc agtgcggcaa cggtgcccgc       240
     tgtttcgccc gtttcgtgcg cctcaagggg ctgatcaacc gggatcgcat cgcggtcagc       300
     acggcgcgcg gccgcatcgt gctgcagctg gaaggggaga accaggtcac ggtcaacatg       360
     ggggtgcccc agttcgagcc gggcaagatc ccgttccggg cccagaaggc ggaaaaaacc       420
     tacctgctgc gggcccagga acatactgtg atgtgcgggg ccgtctccat gggcaatcct       480
     cactgcgtca tcgaggtgcc ctcggtggcc gatgcgccgg tggcgaccct gggtcccatc       540
     atggagcgac acgagcgctt tcccgagcgg gtcaacgtcg gcttcatgga gatggtcaac       600
     gccagcgaga tcaagctgcg ggtgttcgaa cgcggggtgg gcgagaccct ggcctgcggg       660
     accggcgcct gcgcggccgt ggtggtgggc atcagccagg gcaagctcaa ggagcgggtc       720
     accgtcactc tgccgggggg aaagctgacc atcgcctgga aggggccggg tcagccggtc       780
     tacatgaccg ggccggccga gcacgtattt gacggtcaga tagagttata g                831
//

If you have problems or comments...

PBIL Back to PBIL home page