(data stored in ACNUC7421 zone)

EMBL: CP000462.DTD

CP000462.DTD         Location/Qualifiers
FT   CDS_pept        305191..305628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="AHA_0281"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF02580;
FT                   match to protein family HMM TIGR00256"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39550"
FT                   /db_xref="GOA:A0KEZ2"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEZ2"
FT                   /protein_id="ABK39550.1"
FT                   /translation="MIALIQRVSEASVTVEGEMTGAIGQGLLVLLGVEQGDDEAKADKL
FT                   LHKVSGYRIFSDENGKMNLNVSQAGGGLLVVSQFTLAADTNKGMRPSFSGGAHPVEAER
FT                   LYDYFVAQAAASGIPTATGRFAADMKVALVNDGPVTFWLQV"
     gtgattgcac tgattcagcg ggtcagcgag gccagcgtaa cggtagaggg cgagatgacc        60
     ggggctatcg gccaggggct gctggtgctg ctcggggtgg agcagggaga tgacgaggcc       120
     aaggccgaca agctgctgca caaggtgagt ggttaccgca tcttctccga tgagaatggc       180
     aagatgaacc tcaacgtaag ccaggccggc ggcggcctgt tggtggtctc ccagttcacc       240
     ctggcggcgg ataccaacaa ggggatgagg cccagcttct ccggcggcgc ccatccggtc       300
     gaggccgagc ggctgtacga ctacttcgtg gcgcaggccg ctgccagcgg catcccgacc       360
     gccaccggcc gcttcgccgc cgacatgaag gtggcgctgg tcaatgacgg tccggtcacc       420
     ttctggctac aggtctga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page