(data stored in ACNUC7421 zone)

EMBL: CP000462.EDA

CP000462.EDA         Location/Qualifiers
FT   CDS_pept        317302..317943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eda"
FT                   /locus_tag="AHA_0289"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /EC_number="4.1.3.16"
FT                   /note="identified by match to protein family HMM PF01081;
FT                   match to protein family HMM TIGR01182"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38114"
FT                   /db_xref="GOA:A0KF01"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF01"
FT                   /protein_id="ABK38114.1"
FT                   /translation="MQNWKVTPAEVFAASPLVPVMVINELEQALPMAKALLDGGISVFE
FT                   ITLRTPVALEAIALIAKAMPDAMVGAGTVLNCAQFDAAVAAGARFVISPGMTPALLAHA
FT                   ANSTAPLIPGVATPSEVMQALEAGYDHLKFFPAEANGGTKALAAIAAPLPQVKFCPTGG
FT                   IGPKNVADYLALKCVATVGGSWMLPAEAVKNGNWEEVTRLSREAVALVAS"
     atgcagaact ggaaagtgac tccggctgag gtgtttgccg cctccccgct ggtacccgtg        60
     atggtcatca acgagctgga gcaggccctg ccgatggcca aggcgctgct ggacggcggc       120
     atctcggtgt tcgagatcac cctgcgcacc ccggtggcgc tggaggccat cgccctcatc       180
     gccaaggcga tgccggatgc catggtcggt gccggtactg tgctcaactg cgcgcagttt       240
     gacgcggccg tggccgccgg tgcccgcttc gtcatctccc cggggatgac cccggccctg       300
     ctggcccacg cagccaacag cacggcgccg ctgatcccgg gcgtggccac cccgtccgag       360
     gtgatgcagg cgctggaagc gggctacgac cacctcaaat tcttcccggc cgaagcgaac       420
     ggcggcacca aggcgctggc tgccatcgcc gcgccgctgc cccaggtgaa gttctgcccc       480
     accggcggta tcggtccgaa aaacgtggcc gactacctgg cgctcaagtg cgtcgccacc       540
     gtcggcggct cctggatgct gccagccgag gccgtcaaga acggtaactg ggaagaggtg       600
     acccgactct cccgcgaagc cgtcgccctg gtcgcatcct ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page