(data stored in ACNUC7421 zone)

EMBL: CP000462.ENVZ

CP000462.ENVZ        Location/Qualifiers
FT   CDS_pept        332859..334160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /locus_tag="AHA_0306"
FT                   /product="osmolarity sensor protein EnvZ"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by similarity to SP:P02933; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF00672; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35998"
FT                   /db_xref="GOA:A0KF18"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF18"
FT                   /protein_id="ABK35998.1"
FT                   /translation="MSSMFSRMLWFLAAVLVVYQFVSYATFYNYLLAPTVKQISHLLAN
FT                   QVKLIFPVESNQLALSEDAEALVYVATGSDIYTQTEAEQHGLNESKPYTYLEESISREL
FT                   GGKTKVRVEIQDHYIIWIQPPQANKVWVRIPLTEIEDDDIEPLILYMSVLLVVTLFAAW
FT                   RFARQLVRPLEDLEAGAVAVARGNFPDALGEQGSREVRRLTRTFNHMSSSIKGLIEERN
FT                   LMMAGVSHDLRTPLTRIRLATEMMSSGDEYLKESINADIDESNGIIDQFIDYIRPDEGL
FT                   DTQQIDLTQLIHDSLLVQTDQGLEVELELPAEAVRVACNPISIRRILNNLSGNSLRYGA
FT                   SRLQAELKDDGHWVRLRLSDDGPGIPEQDYYRVLKPFTQGNEARTGSGSGLGLAIVAKI
FT                   VSQHHGTIRLGRSELGGLLVEIRLPKNQPLEWID"
     gtgagcagca tgttctcccg catgctctgg tttttggccg ccgtgctggt ggtctatcag        60
     tttgtctcct atgccacctt ctacaactat ctgctggcgc cgaccgtcaa gcagatcagc       120
     cacctgctgg ccaaccaggt caagctcatc ttcccggtcg agagcaacca gctggcgctg       180
     agtgaagatg ccgaggcgct ggtctatgtg gcgaccggca gcgacatcta tacccagacc       240
     gaggcggagc agcacgggct caacgagtcc aagccctaca cctatctgga agagagcatc       300
     agccgcgagc tggggggcaa gaccaaggtc agggtcgaga tccaggatca ctacatcatc       360
     tggatccagc cgccccaggc caataaggtg tgggtgcgca tcccgctgac cgagatcgaa       420
     gatgacgaca tcgagccgct gatcctctac atgagcgtgc tgctggtggt gaccctgttc       480
     gccgcctggc gctttgcccg tcagctggta aggccgctgg aggatctgga ggcgggggcc       540
     gtggcggtgg cgcgtggcaa tttccccgat gcgttggggg agcagggttc gcgggaggtg       600
     cgtcggctga ctcgcacctt caatcacatg tcgagctcca tcaagggcct gatcgaggag       660
     cgcaacctga tgatggcggg cgtctcccac gatctgcgta ccccgctgac ccgtatccgg       720
     ctggcgaccg agatgatgtc ctctggcgat gagtacctca aggagagcat caacgcggac       780
     attgacgagt ccaacggcat catcgatcag ttcatcgact acattcggcc ggacgagggg       840
     ctggataccc agcagatcga cctgacccag ctgatccacg acagcttgct ggtacagacc       900
     gatcagggac tggaggtgga gctcgagttg ccggccgagg cggtacgggt ggcctgcaac       960
     cccatcagca tccgccgcat cctcaacaac ctgtcgggca attcgctgcg ctacggtgcg      1020
     agccggctgc aggccgagct caaggatgat ggtcactggg tgcggttgcg tctgtcggat      1080
     gacggccccg gcattccgga gcaggattac taccgggtgc tcaagccctt cacccagggc      1140
     aacgaggccc gtaccggcag cggcagcggc ctggggttgg ccatcgtcgc caagatagtg      1200
     tcccagcatc atggcaccat caggttgggg cgctccgagc tggggggctt gctggtggag      1260
     atccggctgc ccaagaacca gccgctggag tggattgatt ga                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page