(data stored in ACNUC7421 zone)

EMBL: CP000462.EVGA

CP000462.EVGA        Location/Qualifiers
FT   CDS_pept        68337..68960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="evgA"
FT                   /locus_tag="AHA_0063"
FT                   /product="positive transcription regulator EvgA"
FT                   /note="identified by similarity to SP:P30854; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36068"
FT                   /db_xref="GOA:A0KEB1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEB1"
FT                   /protein_id="ABK36068.1"
FT                   /translation="MAKILVVDDHPAIRMAVNILLQQDDHHIVAEVDNGVDAVLMARKY
FT                   QPDMVVLDIGIPRLDGIEVIKRLKEMDADIKVVILSAQATHHIMVRCLQAGANGFISKL
FT                   DDLSLLKTVLVKIGKGQLYFPRDVIAGAKNAHEVDRKDLLSALSDREMSVLLQICQGQT
FT                   NKQIAESMLLSEKTVSTYKSRLMQKLNVTTMVDLISLAKRQELL"
     atggcaaaaa tattggtagt agatgatcac cccgccatca gaatggctgt aaatatcctg        60
     ctgcagcagg atgatcatca tattgttgcc gaagttgata atggtgttga tgcagttttg       120
     atggcgcgaa aatatcagcc tgatatggtc gttttggata tcgggattcc caggctggac       180
     ggcattgagg tgatcaaaag actgaaagag atggatgctg atatcaaggt ggtcatattg       240
     tctgcacaag caacgcatca tattatggtg cgttgcctgc aagccggtgc caacggtttc       300
     atatccaagc tggatgatct ttccttgctg aaaactgtgc tggtaaagat agggaaaggt       360
     cagctttatt tccctcgcga tgtgattgct ggcgccaaga atgcccatga agtcgatcga       420
     aaagatctct tgtcggcact ctcggataga gagatgagcg tcttgttgca gatatgccag       480
     gggcaaacca acaagcagat tgccgagagc atgctgctga gcgagaagac ggtcagcacc       540
     tacaagagtc ggctgatgca aaagctcaat gtcaccacca tggttgatct gatcagcctg       600
     gccaagcgtc aagagttgct gtga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page