(data stored in ACNUC7421 zone)

EMBL: CP000462.FADA

CP000462.FADA        Location/Qualifiers
FT   CDS_pept        complement(153298..154461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /locus_tag="AHA_0138"
FT                   /product="acetyl-CoA C-acyltransferase FadA"
FT                   /EC_number="2.3.1.16"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM TIGR01930; match to protein family HMM
FT                   TIGR02445"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39512"
FT                   /db_xref="GOA:A0KEL0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEL0"
FT                   /protein_id="ABK39512.1"
FT                   /translation="MKDVVIVDCIRTPMGRSKGGAFRNVRAEDLSAHLMKSILLRNPNL
FT                   DPNEIEDIYWGCVQQTLEQGFNIARNAALLAGIPKQVGAVTVNRLCGSSMQALHDASRA
FT                   IQVGDGDIFIIGGVEHMGHVPMSHGVDFHPGMAKSVAKASGMMGLTAEMLGKLHGISRQ
FT                   QQDEFAARSHRRAHAATVEGRFAKEIVGLEGHDASGARFFYDYDEVIRPETTVETLSQL
FT                   RPVFDPVNGTVTAGTSSALSDGAAAMLVMSADRAKALGLTPRAKIRAMAVAGCDAAIMG
FT                   YGPVPATQKALKRAGLTIGDIDLFELNEAFAAQSLPCVKDLGLQDVVDEKVNLNGGAIA
FT                   LGHPLGCSGARISTTLLNLMEEKDATLGVATMCIGLGQGIATVFERV"
     atgaaagacg tagtcattgt cgactgtatc cggaccccga tgggccggtc caagggcggc        60
     gccttccgca acgtgcgtgc agaagacttg tccgcgcacc tgatgaaatc catcctgctg       120
     cgcaacccca acctcgaccc gaacgagatc gaggatatct actggggctg cgtgcagcag       180
     accctggagc agggcttcaa catcgcccgc aacgcagcct tgctggccgg cattcccaag       240
     caggtggggg cggtcaccgt caaccgcctg tgcggctcca gcatgcaggc gctgcacgat       300
     gcctcccgcg ccattcaggt aggtgatggg gatatcttca tcatcggcgg tgtcgagcac       360
     atgggccacg tgccgatgag ccacggggtg gacttccacc ccggcatggc caagtcggtg       420
     gcgaaagcct ccggcatgat ggggctgacc gccgagatgc tcggcaagct gcacggcatc       480
     agtcgtcagc agcaggacga gtttgccgcc cgctcccatc gtcgcgctca cgccgccacc       540
     gtggaaggac gtttcgccaa ggagatcgtc gggctggaag gccatgacgc cagcggcgcc       600
     cgcttcttct acgactacga cgaggtgatc cgccccgaga ccacggtgga aaccctgagc       660
     cagctgcgcc cggtgttcga cccggtcaac ggcaccgtca ccgccggcac ctcgtcggcc       720
     ctgtccgatg gcgccgccgc catgctggtg atgagtgcgg accgcgccaa ggcgctcggc       780
     ctcaccccgc gcgccaagat acgtgccatg gccgtcgccg gctgcgatgc cgccatcatg       840
     ggttacggcc cggtaccggc cacccagaag gcgctcaagc gggccggcct gaccatcggc       900
     gacatcgacc tgttcgagct gaacgaggcg tttgccgccc agtccctgcc ttgcgtgaag       960
     gatctgggtc tgcaagacgt ggtggatgag aaggtgaacc tgaacggcgg cgccatcgcc      1020
     ctgggtcacc cgctcggctg ctccggcgcc cgcatctcca ccaccctgct caacctgatg      1080
     gaagagaagg acgccaccct gggggttgcc accatgtgca tcggcctggg tcagggcatc      1140
     gccaccgtgt tcgaacgagt gtaa                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page