(data stored in ACNUC7421 zone)

EMBL: CP000462.FADB

CP000462.FADB        Location/Qualifiers
FT   CDS_pept        complement(154483..156630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /locus_tag="AHA_0139"
FT                   /product="fatty oxidation complex, alpha subunit FadB"
FT                   /EC_number="4.2.1.17"
FT                   /EC_number="5.3.3.8"
FT                   /EC_number="1.1.1.35"
FT                   /EC_number="5.1.2.3"
FT                   /note="identified by match to protein family HMM PF00378;
FT                   match to protein family HMM PF00725; match to protein
FT                   family HMM PF02737; match to protein family HMM TIGR02437"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38031"
FT                   /db_xref="GOA:A0KEL1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEL1"
FT                   /protein_id="ABK38031.1"
FT                   /translation="MIYQGETLTVSYLEDGIAELRFDAPGSVNKLDRATLLSLSEAIAA
FT                   LQQERELKGLILTSGKDAFIVGADITEFLELFDLPQADLLGWLKKANDIFSAIEDLPVP
FT                   TLSAIKGHALGGGCETILSTDFRLADTSAKIGLPETKLGIMPGFGGTVRLPRVIGADNA
FT                   LEWITTGKDYRADDALKVGAIDAVVAPDALQSAAVQMIKDAVKGKLDWQGRRAAKKAPL
FT                   RLSKLEAMMSFTTAAGMVAAVAGKHYPAPMTAVKTVEAAAGMSRDEALAVEAQGFIKLA
FT                   KTDVAKALVGIFLNDQHIKALAKKAAKQAAKATSHAAVLGAGIMGGGIAYQSASKGIPA
FT                   VMKDINEKALALGMGEATKLLNGQLEKGRIDGIKMGQVLSAITPTLSYDNVKHVDVVVE
FT                   AVVENPKVKAAVLGEVEGIIGEDAVLASNTSTIPISLLAKELKRPQNFCGMHFFNPVHR
FT                   MPLVEIIRGEQTSDETINRVVAYAAAMGKSPVVVNDCPGFFVNRVLFPYFFGFNKLVAD
FT                   GADFAAVDKVMEKEFGWPMGPAYLLDVVGIDTGHHAGDVMAQGFPARMSKEGRTAIDVM
FT                   YEVNRFGQKNGKGFYAYEQDKKGKPKKVADAASYELLAPIAKPKQDFDKDAIIARMMIP
FT                   MINEVVLCLEEGIVATPAEADIALVYGLGFPPFRGGVFRYLDTIGLDRYVAMADQYADL
FT                   GPLYRVSDKLREMAAQGKTFY"
     atgatctacc aaggcgaaac cctgacggtc agctacctcg aagacggcat tgccgagctg        60
     aggtttgatg ccccgggttc agtcaacaag ctggatcgcg ctaccctgct ctccctgagc       120
     gaagcgatcg ccgcattaca acaagaacgt gaactaaaag gtctgatcct cacctccggc       180
     aaagacgcct tcatcgtcgg cgccgacatt accgaattcc tggaactgtt cgatctgccg       240
     caggctgatc tgctcggctg gctgaaaaag gccaacgaca tcttcagcgc catcgaagat       300
     ctgccggtgc ccaccctctc cgctatcaag ggccacgccc taggcggcgg ctgcgagacc       360
     attctctcca ccgacttccg actggctgac accagcgcca agattggcct gcccgagacc       420
     aaactcggca tcatgccggg ctttggcggc accgtccgtc tgccgcgggt gatcggcgcc       480
     gacaacgcgc tcgagtggat caccaccggc aaggattacc gtgccgatga cgccctcaag       540
     gtgggtgcca tcgacgccgt ggtcgccccg gacgcgctgc aaagcgccgc cgtgcagatg       600
     atcaaggacg cggtcaaggg caagctggac tggcagggcc gccgcgccgc caagaaggcc       660
     ccgctgcgcc tctccaaact ggaagccatg atgagcttca ccaccgccgc cggcatggtt       720
     gctgccgtgg cgggcaaaca ctatccggcc ccgatgacgg cggtgaaaac cgtcgaggcc       780
     gccgccggca tgagtcgtga cgaggcgctg gccgtcgaag cgcagggctt catcaagctg       840
     gccaagaccg atgtcgccaa ggcgctggtc ggtatcttcc tcaacgatca gcacatcaag       900
     gcgctggcca agaaggcggc caagcaggca gctaaggcca ctagccatgc cgccgtactg       960
     ggtgccggca tcatgggtgg cggcatcgcc taccagtctg ccagcaaggg tatcccggca      1020
     gtgatgaagg acatcaacga gaaggcgctg gcacttggca tgggtgaagc caccaagctg      1080
     cttaacggcc agctcgaaaa gggccgcatc gacggcatca agatgggcca ggtgctctcc      1140
     gccatcaccc cgactctcag ctatgacaac gtcaagcatg tggatgtggt ggtcgaagcc      1200
     gtggtcgaga acccgaaagt gaaagccgcc gtactgggcg aagtggaagg gatcatcggc      1260
     gaagacgccg tgctcgccag caacacctcc accattccca tctccctgct ggccaaggag      1320
     ctgaagcgcc cgcagaactt ctgcggcatg cacttcttca acccggtaca ccgcatgccg      1380
     ctggtggaga tcatccgcgg cgagcagacc tccgatgaaa ccatcaaccg cgtggtggcc      1440
     tacgccgccg ccatgggcaa gtccccggtg gtagtcaacg actgcccggg cttcttcgtc      1500
     aaccgggtgc tgttccccta cttcttcggt ttcaacaagc tggtcgccga tggcgccgac      1560
     ttcgctgccg tcgacaaggt gatggagaag gaatttggct ggccgatggg ccccgcctac      1620
     ctgctggacg tggtcggcat cgacaccggc caccacgccg gtgacgtcat ggcgcagggc      1680
     ttcccggcac gcatgagcaa ggaaggccgc accgccatcg acgtgatgta cgaagtgaac      1740
     cgcttcggtc agaagaacgg caagggcttc tacgcctacg agcaggacaa gaagggcaag      1800
     ccgaagaagg tggccgacgc cgccagctac gagctgctag cccccatcgc caagccgaag      1860
     caggatttcg acaaggacgc catcatcgcc cgcatgatga tcccgatgat caacgaggta      1920
     gtgctctgtc tggaagaggg catagtcgcc acgccagccg aagccgacat cgcactggtc      1980
     tacggtctgg gcttccctcc cttccgcggc ggcgtgttcc gctatctgga cactatcggt      2040
     ctggatcgct acgtggccat ggccgaccag tatgccgact tgggcccgct ctaccgcgtc      2100
     agcgacaagc tgcgtgagat ggccgcccag ggcaaaacct tttactga                   2148
//

If you have problems or comments...

PBIL Back to PBIL home page