(data stored in ACNUC7421 zone)

EMBL: CP000462.FTSE

CP000462.FTSE        Location/Qualifiers
FT   CDS_pept        388413..389081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="AHA_0372"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR02673"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38753"
FT                   /db_xref="GOA:A0KF79"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF79"
FT                   /protein_id="ABK38753.1"
FT                   /translation="MIRFDKVSKVYSGGHQALQKVSFHLRKGEMAFLTGHSGAGKSTLL
FT                   KLISVMERPTDGRVFFHGDDVSHIKRGEIPYVRRQIGMIFQDHRLLMDRTVFDNVALPL
FT                   VIDGYSHADINKRVAAALDKVGLLGKERYQPRMLSGGEQQRVGIARAIVNKPPLLLADE
FT                   PTGNLDPQLSMDIMRLFEEFNRFGVSVLIATHDLGLIARMRYRTLTLKAGRMYSAGEEL
FT                   "
     atgatccgtt ttgacaaggt cagcaaggtc tacagcggcg gccatcaggc gctgcagaag        60
     gtcagttttc acctgcgcaa gggggagatg gccttcctga ccggacactc gggtgcaggc       120
     aagagtaccc tcctcaaact catcagtgtg atggaacggc ccaccgacgg ccgtgtgttc       180
     tttcatggcg acgacgtcag ccatatcaag cggggggaga tcccctatgt gcgccgccag       240
     atcggcatga tcttccagga tcaccggctg ctgatggacc gcaccgtgtt cgacaacgtg       300
     gcgttgccgc tggtgatcga cggttacagc catgcagaca tcaacaaacg ggttgcggcg       360
     gcgctcgaca aggtggggct gctcggcaag gaacgctacc agccgcgcat gctctccggc       420
     ggggaacagc agcgggtcgg catcgcccgc gccatcgtca acaagccgcc gctgctgctg       480
     gcggatgagc cgaccggcaa cctggatccc cagctctcca tggacatcat gcgactgttc       540
     gaggagttca accgcttcgg cgtctccgtg ctgattgcca cccatgatct ggggctgatc       600
     gcccgcatgc gctatcgcac cctgaccctc aaggcgggtc gcatgtattc ggcaggggag       660
     gagctctga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page