(data stored in ACNUC7421 zone)

EMBL: CP000462.GLNA

CP000462.GLNA        Location/Qualifiers
FT   CDS_pept        complement(300492..301901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="AHA_0277"
FT                   /product="glutamine synthetase, type I"
FT                   /EC_number="6.3.1.2"
FT                   /note="identified by match to protein family HMM PF00120;
FT                   match to protein family HMM PF03951; match to protein
FT                   family HMM TIGR00653"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37740"
FT                   /db_xref="GOA:A0KEY9"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEY9"
FT                   /protein_id="ABK37740.1"
FT                   /translation="MSAQNVLALIQEHEVKFVDLRFTDTKGKEQHVSIPSHQVDEDFFE
FT                   DGKMFDGSSIGGWKGINESDMVLMPDAASAKLDPFTEETTLNIVCDVLEPATMQGYDRD
FT                   PRSIAKRAEDFLKSSGIADTVLFGPEPEFFMFDNITFSNTMGHSFVKIESEEAAWNSGT
FT                   DYEHGNKGHRPFVKGGYFPVAPVDSSQDIRAAMCLVLEEMGQVVEAHHHEVATAGQNEI
FT                   ATRFNTLTLKADEVQVLKYVIHNVAHAYNKTVTFMPKPMFGDNGSGMHCHQSLAKNGVN
FT                   LFAGDLYGGLSEMALHYIGGIIKHAKAINAFANPTTNSYKRLVPGYEAPVMLAYSARNR
FT                   SASIRIPVVPSPKARRIEVRFPDPAANPYLAFAAQLMAGLDGIINKIHPGDAMDKNLYD
FT                   LPPEEAAEVPTVAGSLDEALAALDADREFLTRGGVFSDDFINSYLELKQQDVDRVRMTP
FT                   HPLEFELYYSV"
     atgtcagccc agaacgtttt ggccctgatc caggaacacg aagtcaagtt tgtcgacctg        60
     cgctttaccg acaccaaggg taaagagcag cacgtatcca tcccttccca tcaggttgac       120
     gaagatttct tcgaagacgg caagatgttc gatggttcct ccatcggcgg ctggaagggt       180
     atcaacgaat cagacatggt gctgatgccg gatgcggcct cagccaaact ggatccgttc       240
     actgaagaga ccaccctgaa catcgtctgt gacgtgctgg aaccggccac catgcagggc       300
     tacgaccgcg atccgcgctc catcgccaag cgtgccgaag acttcctgaa gtccagcggc       360
     atcgccgaca ccgtgctgtt cgggccggag ccggaattct tcatgttcga caacatcact       420
     ttctcgaaca ccatgggcca cagcttcgtg aagatcgaat ccgaagaagc cgcctggaac       480
     tccggtaccg attacgagca cggcaacaag ggtcaccgtc ctttcgtcaa gggtggctac       540
     ttcccggtcg caccggtcga ctcctctcag gacatccgtg ccgccatgtg tctggtgctg       600
     gaagagatgg gccaggtcgt tgaagctcac caccacgaag tggcgactgc cggtcagaac       660
     gagatcgcga cccgtttcaa caccctcacc ctgaaagcgg atgaagtgca ggtactgaag       720
     tacgtgatcc acaacgtggc ccacgcctac aacaagaccg tcaccttcat gccgaaaccc       780
     atgttcggtg acaacggctc cggcatgcac tgccaccagt ccctggccaa gaacggcgtc       840
     aacctgttcg ccggcgacct gtacggcggt ctgtccgaga tggcgctgca ctacatcggc       900
     ggcatcatca agcacgccaa ggccatcaac gccttcgcca acccgaccac caactcctac       960
     aagcgtctgg taccgggtta tgaagcaccg gtcatgctgg cctactctgc ccgcaaccgc      1020
     tctgcctcca tccgtatccc ggtcgtgccg agcccgaaag ctcgccgcat cgaagtccgc      1080
     ttcccggatc cggctgccaa cccgtacctg gccttcgcag cccagctgat ggccggtctg      1140
     gacggcatca tcaacaagat ccatccgggc gatgccatgg acaagaactt gtatgacctg      1200
     ccgccggaag aagccgccga agtgccgacc gttgccggtt ctctggacga agccctggcc      1260
     gcgctggatg cggatcgcga gttcctgacc cgcggcggcg tattcagcga cgacttcatc      1320
     aactcctatc tggagctgaa gcagcaggac gttgaccgcg tgcgcatgac tccgcacccg      1380
     ctggagttcg aactgtacta ctccgtttaa                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page