(data stored in ACNUC7421 zone)

EMBL: CP000462.GLNL

CP000462.GLNL        Location/Qualifiers
FT   CDS_pept        complement(298682..299737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnL"
FT                   /locus_tag="AHA_0275"
FT                   /product="nitrogen regulation protein NR(II)"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by similarity to SP:P06712; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF00989; match to protein family HMM PF02518; match to
FT                   protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37246"
FT                   /db_xref="GOA:A0KEY7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEY7"
FT                   /protein_id="ABK37246.1"
FT                   /translation="MPTRPDQAKILLDNLLTAVILMDERLCIQFVNPAAEQLLSLSQRR
FT                   LIGIELPHLLEHISLDLQRLKQCLSSGQGFTDSEVTLVVEGEPRLVEMSVSPLADHEQR
FT                   LMVVELRKIDQQKKISQELQQHAQQQAAKELVRGLAHEIKNPLGGLRGAAQLLQKELPD
FT                   PALREYTGIIIEQADRLRVLVDRLLGPQRPGRHQMHNVHSVLEQVRRLVELELPPTVRI
FT                   ERDYDPSIPEFEMEPDQLQQAFLNMVRNAAEAIGEQTGLIRIKTRTAFQITIHGQRYRL
FT                   AAEIKIIDNGPGIPDAIRDTLFYPMITGKEGGTGLGLSIAQNLIDQHKGRIDCISWPGH
FT                   TEFTIFLPLRK"
     gtgccaaccc gcccggatca agccaagata ctgctcgata acttgctgac cgccgtcatc        60
     ctgatggatg aacggctctg catacaattc gtcaacccgg ccgccgagca gctgctctcc       120
     ctcagtcagc gccggctgat cggtatcgag ctaccccatc tgctggaaca catctccctc       180
     gatctgcagc ggctcaagca gtgcctcagc tcggggcagg gcttcaccga cagcgaagtc       240
     accctggtgg tggaagggga gcccagactg gtggagatga gcgtcagccc gctggccgat       300
     catgagcagc ggctgatggt ggtagagctg cgcaagatcg accagcagaa gaagatcagc       360
     caggagctgc agcagcatgc ccagcaacag gcggccaagg agctggtgcg cggcctggcc       420
     cacgagatca agaatcccct cggcggtctg cgcggtgcgg cccagctgct gcaaaaggag       480
     ctgcccgacc ccgccctgcg cgaatacacc ggcatcatca tcgaacaggc cgaccggctg       540
     cgggtgctgg tcgatcggtt gctcggcccc cagcgcccgg gtcgtcacca gatgcacaac       600
     gtgcactcgg tgctggagca ggtgcgccgg ctggtagagc tggagctacc gccgacggta       660
     cgcatcgagc gggattacga tcccagcatc ccggagttcg agatggaacc ggaccagctg       720
     cagcaggcct tcctcaacat ggtgcgcaac gccgccgagg ccatcggcga gcagaccggc       780
     ctcatccgca tcaagacccg caccgcgttc cagatcacca tccacggcca gcgctaccgg       840
     ctggcggccg agatcaagat catcgacaac ggccccggca tcccggatgc catccgcgac       900
     accctcttct atccgatgat caccggcaag gaggggggca ccgggctcgg cctctccatc       960
     gcccagaacc tgatcgacca gcacaagggg cggatcgact gcatcagctg gcccggccac      1020
     accgaattca ccatctttct accgcttcgc aaataa                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page