(data stored in ACNUC7421 zone)

EMBL: CP000462.GLYQ

CP000462.GLYQ        Location/Qualifiers
FT   CDS_pept        complement(143457..144380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="AHA_0128"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF02091;
FT                   match to protein family HMM TIGR00388"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36453"
FT                   /db_xref="GOA:A0KEK0"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEK0"
FT                   /protein_id="ABK36453.1"
FT                   /translation="MQKFDVKTFQGLILQLQDYWSRQGCTIIQPLDMEVGAGTSHPMTC
FT                   LRALGPEPIACAYVQPSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKE
FT                   LGMDPEIHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEI
FT                   TYGLERLAMYIQGVDSVYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEHADVEFLFHC
FT                   FEQYEKEAQNLLALEKPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTK
FT                   AVAEAYYASREALGFPMCQRSENKQG"
     atgcaaaaat tcgatgtcaa aacctttcag ggcctgatcc tgcagctgca ggactattgg        60
     tcccgccagg gctgtaccat cattcagccg ctggatatgg aagtgggtgc cggtacttct       120
     caccccatga cctgcctgcg cgccctgggc cccgagccca tcgcctgcgc ctacgtgcaa       180
     ccgtcccgcc gtccgactga cggccgctac ggtgaaaacc cgaaccgcct gcagcactac       240
     taccagttcc aggtgatcat caagccttcc cccgacaaca ttcaggaact ctatctgggc       300
     tccctgaaag agctgggcat ggatcccgag atccacgaca tccgcttcgt ggaagacaac       360
     tgggaaaacc cgacgctggg tgcctggggt ctgggctggg aagtgtggct gaacggcatg       420
     gaagtgaccc agttcaccta cttccagcaa gttggcggcc tcgagtgcaa gccggtcacc       480
     ggcgagatca cctacggtct cgagcgtctg gccatgtaca tccagggcgt ggacagcgtc       540
     tacgatctgg tctggtctga cggcccgctg ggcaagacca cctacggcga cgtgttccac       600
     caaaacgaag tggagcaatc cacctacaac ttcgaacacg ccgacgtgga gttcctgttc       660
     cactgcttcg agcagtacga gaaggaagcc cagaatctgc tggcactgga aaaaccgctg       720
     ccgctgcctg cctacgagcg catcctcaaa gccgctcact ccttcaacct gctggatgcc       780
     cgcaaggcca tctcggtcac cgagcgtcag cgctacatcc tgcgcattcg caccctgacc       840
     aaggccgtgg cagaggcata ctacgcctcc cgcgaagcgc tgggcttccc gatgtgtcag       900
     cgcagtgaga acaagcaagg ttaa                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page