(data stored in ACNUC7421 zone)

EMBL: CP000462.GNTY

CP000462.GNTY        Location/Qualifiers
FT   CDS_pept        complement(325126..325704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntY"
FT                   /locus_tag="AHA_0297"
FT                   /product="protein GntY"
FT                   /note="identified by similarity to SP:P63020; match to
FT                   protein family HMM PF01106; match to protein family HMM
FT                   PF01521"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38584"
FT                   /db_xref="GOA:A0KF09"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF09"
FT                   /protein_id="ABK38584.1"
FT                   /translation="MISISDTAQAHFRKLLEKQPDGTNIRVFVVNPGTQNAECGVSYCP
FT                   PDAVDPEDQHLPFSGFDCLVDPLSAPFLVDATIDFVTDQMGSQLTLKAPNAKMRKVADD
FT                   APLIDRIEYVLMSEVNPMLAGHGGKVTLVELTEDKLAILQFGGGCNGCSMVDYTLKEGI
FT                   EKQLLEKFPGELNGVKDATEHQRGDHSYY"
     atgatcagca tttccgacac cgcccaggcc catttccgta aactgctgga aaaacagcct        60
     gatggcacca atatccgggt gtttgtggtc aatccgggaa cccagaatgc cgagtgcggc       120
     gtatcatatt gcccacccga cgcggtcgat ccggaagatc aacacctgcc cttcagcggc       180
     ttcgactgcc tggtcgatcc cctgagcgcc cccttcctgg tggatgccac catcgatttc       240
     gtcaccgatc agatgggctc ccagctcacc ctgaaagccc cgaacgccaa gatgcgcaaa       300
     gtggccgacg acgccccgct gatcgaccgt atcgagtacg tgttgatgtc cgaggtgaac       360
     cccatgctgg ccggtcacgg cggcaaggtc accctggtcg agctgaccga ggacaagctg       420
     gccattctgc agttcggcgg cggttgcaac ggttgctcca tggtcgacta caccctgaaa       480
     gaggggatcg agaagcagct gctggagaaa ttccccggcg agctcaacgg tgtcaaggat       540
     gccaccgagc accagcgcgg cgatcactcc tactactga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page